DDOST, Human
DDOST is a key subunit of the oligosaccharyltransferase (OST) complex, which catalyzes the initial glycan transfer during protein N-glycosylation. This co-translational process begins with the transfer of defined glycans to asparagine residues in the nascent polypeptide chain. DDOST Protein, Human is the recombinant human-derived DDOST protein, expressed by E. coli , with tag free.
Product Specifications
Product Name Alternative
DDOST Protein, Human, Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/ddost-protein-human.html
Purity
95.00
Smiles
SGPRTLVLLDNLNVRETHSLFFRSLKDRGFELTFKTADDPSLSLIKYGEFLYDNLIIFSPSVEDFGGNINVETISAFIDGGGSVLVAASSDIGDPLRELGSECGIEFDEEKTAVIDHHNYDISDLGQHTLIVADTENLLKAPTIVGKSSLNPILFRGVGMVADPDNPLVLDILTGSSTSYSFFPDKPITQYPHAVGKNTLLIAGLQARNNARVIFSGSLDFFSDSFFNSAVQKAAPGSQRYSQTGNYELAVALSRWVFKEEGVLRVGPVSHHRVGETAPPNAYTVTDLVEYSIVIQQLSNGKWVPFDGDDIQLEFVRIDPFVRTFLKKKGGKYSVQFKLPDVYGVFQFKVDYNRLGYTHLYSSTQVSVRPLQHTQYERFIPSAYP
Molecular Formula
1650 (Gene_ID) P39656-1 (S43-P427) (Accession)
Molecular Weight
Approximately 44 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
037162-AP 200 µL
ITPA, NT (ITPA, C20orf37, Inosine triphosphate pyrophosphatase, Non-canonical purine NTP pyrophosphatase, Non-standard purine NTP pyrophosphatase, Nucleoside-triphosphate diphosphatase, Nucleoside-triphosphate pyrophosphatase, Putative oncogene protein hlc14-06-p) (AP) discontinued
Sign In for Pricing
View Details 
RDR-MMP10-Ra-96Tests 96 Tests
Rat Matrix Metalloproteinase 10 (MMP10) ELISA Kit
Sign In for Pricing
View Details 