Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Iron-sulfur cluster assembly enzyme ISCU, mitochondrial (ISCU)

Product Specifications

Product Name Alternative

NifU-like N-terminal domain-containing protein (NifU-like protein) (NIFUN)

Abbreviation

Recombinant Human ISCU protein

Gene Name

ISCU

UniProt

Q9H1K1

Expression Region

35-167aa

Organism

Homo sapiens (Human)

Target Sequence

YHKKVVDHYENPRNVGSLDKTSKNVGTGLVGAPACGDVMKLQIQVDEKGKIVDARFKTFGCGSAIASSSLATEWVKGKTVEEALTIKNTDIAKELCLPPVKLHCSMLAEDAIKAALADYKLKQEPKKGEAEKK

Tag

N-terminal 6xHis-sumostar-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Metabolism

Relevance

Scaffold protein for the de novo synthesis of iron-sulfur clusters within mitochondria, which is required for maturation of both mitochondrial and cytoplasmic [2Fe-2S] and [4Fe-4S] proteins . First, a [2Fe-2S] cluster is transiently assembled on the scaffold protein ISCU. In a second step, the cluster is released from ISCU, transferred to a glutaredoxin GLRX5, followed by the formation of mitochondrial [2Fe-2S] proteins, the synthesis of [4Fe-4S] clusters and their target-specific insertion into the recipient apoproteins. Cluster assembly on ISCU depends on the function of the cysteine desulfurase complex NFS1-LYRM4/ISD11, which serves as the sulfur donor for cluster synthesis, the iron-binding protein frataxin as the putative iron donor, and the electron transfer chain comprised of ferredoxin reductase and ferredoxin, which receive their electrons from NADH.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

27.5 kDa

References & Citations

"Characterization of the human HSC20, an unusual DnaJ type III protein, involved in iron-sulfur cluster biogenesis." Uhrigshardt H., Singh A., Kovtunovych G., Ghosh M., Rouault T.A. Hum. Mol. Genet. 19:3816-3834 (2010)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ITGA5, ID (ITGA5, FNRA, Integrin alpha-5, CD49 antigen-like family member E, Fibronectin receptor subunit alpha, Integrin alpha-F, VLA-5, CD49e, Integrin alpha-5 heavy chain, Integrin alpha-5 light chain) (Azide free) (HRP) discontinued
037136-HRP 200 µL

ITGA5, ID (ITGA5, FNRA, Integrin alpha-5, CD49 antigen-like family member E, Fibronectin receptor subunit alpha, Integrin alpha-F, VLA-5, CD49e, Integrin alpha-5 heavy chain, Integrin alpha-5 light chain) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
Total MMP-9 (Human) OmniKine™ ELISA Kit
OK-0277 1 Kit

Total MMP-9 (Human) OmniKine™ ELISA Kit

Sign In for Pricing
View Details
Bcl2 Like Protein 14 (BCL2L14) Antibody
abx111210 100 µL

Bcl2 Like Protein 14 (BCL2L14) Antibody

Sign In for Pricing
View Details
Recombinant Mouse Frizzled 1/FZD1 Protein (Fc Tag)
PKSM041027-01 10 µg

Recombinant Mouse Frizzled 1/FZD1 Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Mouse Frizzled 1/FZD1 Protein (Fc Tag)
PKSM041027-02 50 µg

Recombinant Mouse Frizzled 1/FZD1 Protein (Fc Tag)

Sign In for Pricing
View Details
OTUD6B (NM_001286745) Human Untagged Clone
SC334349 10 µg

OTUD6B (NM_001286745) Human Untagged Clone

Sign In for Pricing
View Details