Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TFPI2, Mouse (189a.a, HEK293, His)

TFPI2 (tissue factor pathway inhibitor 2) is a key regulator of matrix remodeling and has inhibitory control effects on trypsin, plasmin and factor VIIa/tissue factor. It has a weak effect on factor Xa and has no effect on thrombin. Its complex interactions extend to the formation of molecular complexes with ABCB1 and PPP2R3C, resulting in dephosphorylation of ABCB1. TFPI2 Protein, Mouse (189a.a, HEK293, His) is the recombinant mouse-derived TFPI2 protein, expressed by HEK293 , with His labeled tag.

Product Specifications

Product Name Alternative

TFPI2 Protein, Mouse (189a.a, HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tfpi2-protein-mouse-hek-293-c-his.html

Purity

96.00

Smiles

LTSVSAQGNNLEICLLPLDAGPCQALIPKFYYDRDQQKCRRFNYGGCLGNANNFHSRDLCQQTCGSIEKVPPVCRSELKTYPCDKPNIRFFFNLNTMTCEPLRPGLCSRTINVFSEEATCKGLCEPRKHIPSFCSSPKDEGLCSANVTRFYFNSRNKTCETFTYTGCGGNENNFYYLDACHRACVKGWK

Molecular Formula

21789 (Gene_ID) O35536 (L23-K211) (Accession)

Molecular Weight

Approximately 25-35 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

DUSP6 Rabbit Polyclonal antibody
S0B0781-01 1 mL

DUSP6 Rabbit Polyclonal antibody

Sign In for Pricing
View Details
DUSP6 Rabbit Polyclonal antibody
S0B0781-02 25 µL

DUSP6 Rabbit Polyclonal antibody

Sign In for Pricing
View Details
DUSP6 Rabbit Polyclonal antibody
S0B0781-03 100 µL

DUSP6 Rabbit Polyclonal antibody

Sign In for Pricing
View Details
Guinea pig Ubiquitin (Ub) ELISA Kit
MBS450504-01 48 Tests

Guinea pig Ubiquitin (Ub) ELISA Kit

Sign In for Pricing
View Details
Guinea pig Ubiquitin (Ub) ELISA Kit
MBS450504-02 96 Tests

Guinea pig Ubiquitin (Ub) ELISA Kit

Sign In for Pricing
View Details
Guinea pig Ubiquitin (Ub) ELISA Kit
MBS450504-03 5x 96 Tests

Guinea pig Ubiquitin (Ub) ELISA Kit

Sign In for Pricing
View Details