Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TFPI2, Mouse (189a.a, HEK293, His)

TFPI2 (tissue factor pathway inhibitor 2) is a key regulator of matrix remodeling and has inhibitory control effects on trypsin, plasmin and factor VIIa/tissue factor. It has a weak effect on factor Xa and has no effect on thrombin. Its complex interactions extend to the formation of molecular complexes with ABCB1 and PPP2R3C, resulting in dephosphorylation of ABCB1. TFPI2 Protein, Mouse (189a.a, HEK293, His) is the recombinant mouse-derived TFPI2 protein, expressed by HEK293 , with His labeled tag.

Product Specifications

Product Name Alternative

TFPI2 Protein, Mouse (189a.a, HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tfpi2-protein-mouse-hek-293-c-his.html

Purity

96.00

Smiles

LTSVSAQGNNLEICLLPLDAGPCQALIPKFYYDRDQQKCRRFNYGGCLGNANNFHSRDLCQQTCGSIEKVPPVCRSELKTYPCDKPNIRFFFNLNTMTCEPLRPGLCSRTINVFSEEATCKGLCEPRKHIPSFCSSPKDEGLCSANVTRFYFNSRNKTCETFTYTGCGGNENNFYYLDACHRACVKGWK

Molecular Formula

21789 (Gene_ID) O35536 (L23-K211) (Accession)

Molecular Weight

Approximately 25-35 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human LAMC2 Protein - (Dry Ice)
H00003918-Q01-25ug 25 µg

Recombinant Human LAMC2 Protein - (Dry Ice)

Sign In for Pricing
View Details
FAM20C Human qPCR Template Standard (BC040074)
HK200150 1 Kit

FAM20C Human qPCR Template Standard (BC040074)

Sign In for Pricing
View Details
Rabbit Anti-Goat IgG Fc-UNLB
MBS675151-01 0.5 mg

Rabbit Anti-Goat IgG Fc-UNLB

Sign In for Pricing
View Details
Rabbit Anti-Goat IgG Fc-UNLB
MBS675151-02 5x 0.5 mg

Rabbit Anti-Goat IgG Fc-UNLB

Sign In for Pricing
View Details
Prelp Mouse shRNA Plasmid (Locus ID 116847)
TL506000 1 Kit

Prelp Mouse shRNA Plasmid (Locus ID 116847)

Sign In for Pricing
View Details
GENLISA Human Prostaglandin E1 (PGE1) ELISA
KBH15065 1x 96 Well

GENLISA Human Prostaglandin E1 (PGE1) ELISA

Sign In for Pricing
View Details