Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Kallikrein-5, Mouse (HEK293, His)

The Kallikrein-5 protein may be involved in desquamation, suggesting a role in the process of skin shedding and exfoliation. Its association with desquamation suggests that it plays a role in regulating the removal of dead skin cells, which is critical for skin homeostasis. Kallikrein-5 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Kallikrein-5 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

Kallikrein-5 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/kallikrein-5-protein-mouse-hek293-his.html

Purity

95.00

Smiles

GDVSSCDNPSGTEPSGTNRDLSTDSKSGEDTRSDSSSRIVNGSDCQKDAQPWQGALLLGPNKLYCGAVLISPQWLLTAAHCRKPVFRIRLGHHSMSPVYESGQQMFQGIKSIPHPGYSHPGHSNDLMLIKMNRKIRDSHSVKPVEIACDCATEGTRCMVSGWGTTSSSHNNFPKVLQCLNITVLSEERCKNSYPGQIDKTMFCAGDEEGRDSCQGDSGGPVVCNGKLQGLVSWGDFPCAQRNRPGVYTNLCEFVKWIKDTMNSN

Molecular Formula

68668 (Gene_ID) Q9D140 (G30-N293) (Accession)

Molecular Weight

40-50 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ICG Maleimide
HY-D1744-01 5 mg

ICG Maleimide

Sign In for Pricing
View Details
ICG Maleimide
HY-D1744-02 10 mg

ICG Maleimide

Sign In for Pricing
View Details
ICG Maleimide
HY-D1744-03 25 mg

ICG Maleimide

Sign In for Pricing
View Details
Influenza A Virus IgA Control Serum
C1231A-1 3 mL

Influenza A Virus IgA Control Serum

Sign In for Pricing
View Details
IFluor® 700 Anti-human CD43 Antibody *HI165*
104300J1-AAT 500 Tests

IFluor® 700 Anti-human CD43 Antibody *HI165*

Sign In for Pricing
View Details
Aryl Hydrocarbon Receptor Rabbit Monoclonal Antibody
E10G21080 100 µL

Aryl Hydrocarbon Receptor Rabbit Monoclonal Antibody

Sign In for Pricing
View Details