Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-1RA/IL-1RN, Cynomolgus (His)

IL-1RA/IL-1RN mutant proteins are potent anti-inflammatory antagonists of the interleukin 1 family, specifically targeting the proinflammatory cytokines IL1B and IL1A. This mutant variant is designed for enhanced suppressive capacity, tightly protecting the host from immune dysregulation and preventing IL1 from triggering uncontrolled systemic inflammation in response to innate stimulators. IL-1RA/IL-1RN Protein, Cynomolgus (His) is the recombinant cynomolgus-derived IL-1RA/IL-1RN mutant protein, expressed by E. coli , with C-10*His labeled tag.

Product Specifications

Product Name Alternative

IL-1RA/IL-1RN Protein, Cynomolgus (His), Cynomolgus, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-1ra-il-1rn-protein-cynomolgus-his.html

Purity

97.00

Smiles

RPSGRKPSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSKNRKQDKRFAFVRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDKGVMVTKFYFQEDE

Molecular Formula

102126145 (Gene_ID) NP_001270468.1 (R26-E177) (Accession)

Molecular Weight

Approximately 18-25 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPINK2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
45332111 3x 1.0 µg

SPINK2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Recombinant Human TEX9 Protein
E30P9362 20 µg

Recombinant Human TEX9 Protein

Sign In for Pricing
View Details
BIRC5 (NM_001168) Human Tagged Lenti ORF Clone
RC205935L2 10 µg

BIRC5 (NM_001168) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Frozen Tissue Sections, Myometrium
CS600602 5x 5 µm

Frozen Tissue Sections, Myometrium

Sign In for Pricing
View Details
Carbonic Anhydrase 2 (CA2) Antibody Pair
abx370724-01 5x 96 Tests

Carbonic Anhydrase 2 (CA2) Antibody Pair

Sign In for Pricing
View Details
Carbonic Anhydrase 2 (CA2) Antibody Pair
abx370724-02 10x 96 Tests

Carbonic Anhydrase 2 (CA2) Antibody Pair

Sign In for Pricing
View Details