Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-1RA/IL-1RN, Cynomolgus (His)

IL-1RA/IL-1RN mutant proteins are potent anti-inflammatory antagonists of the interleukin 1 family, specifically targeting the proinflammatory cytokines IL1B and IL1A. This mutant variant is designed for enhanced suppressive capacity, tightly protecting the host from immune dysregulation and preventing IL1 from triggering uncontrolled systemic inflammation in response to innate stimulators. IL-1RA/IL-1RN Protein, Cynomolgus (His) is the recombinant cynomolgus-derived IL-1RA/IL-1RN mutant protein, expressed by E. coli , with C-10*His labeled tag.

Product Specifications

Product Name Alternative

IL-1RA/IL-1RN Protein, Cynomolgus (His), Cynomolgus, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-1ra-il-1rn-protein-cynomolgus-his.html

Purity

97.00

Smiles

RPSGRKPSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSKNRKQDKRFAFVRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDKGVMVTKFYFQEDE

Molecular Formula

102126145 (Gene_ID) NP_001270468.1 (R26-E177) (Accession)

Molecular Weight

Approximately 18-25 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PSMG4 Recombinant Protein (Mouse)
RP165386 100 µg

PSMG4 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Olr1353 Recombinant Protein (Rat)
RP215906 100 µg

Olr1353 Recombinant Protein (Rat)

Sign In for Pricing
View Details
Mouse Monoclonal MAML3 Antibody (MAML3/1303) [Janelia Fluor 646]
NBP2-54309JF646 0.1 mL

Mouse Monoclonal MAML3 Antibody (MAML3/1303) [Janelia Fluor 646]

Sign In for Pricing
View Details
Krt28 (NM_027574) Mouse Tagged ORF Clone
MG219963 10 µg

Krt28 (NM_027574) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Mettl21e (NM_207281) Mouse Tagged ORF Clone Lentiviral Particle
MR212609L4V 200 µL

Mettl21e (NM_207281) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
CD243 Antibody (FITC)
GWB-71F7C3 0.1 mg

CD243 Antibody (FITC)

Sign In for Pricing
View Details