Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-1RA/IL-1RN, Cynomolgus (His)

IL-1RA/IL-1RN mutant proteins are potent anti-inflammatory antagonists of the interleukin 1 family, specifically targeting the proinflammatory cytokines IL1B and IL1A. This mutant variant is designed for enhanced suppressive capacity, tightly protecting the host from immune dysregulation and preventing IL1 from triggering uncontrolled systemic inflammation in response to innate stimulators. IL-1RA/IL-1RN Protein, Cynomolgus (His) is the recombinant cynomolgus-derived IL-1RA/IL-1RN mutant protein, expressed by E. coli , with C-10*His labeled tag.

Product Specifications

Product Name Alternative

IL-1RA/IL-1RN Protein, Cynomolgus (His), Cynomolgus, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-1ra-il-1rn-protein-cynomolgus-his.html

Purity

97.00

Smiles

RPSGRKPSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSKNRKQDKRFAFVRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDKGVMVTKFYFQEDE

Molecular Formula

102126145 (Gene_ID) NP_001270468.1 (R26-E177) (Accession)

Molecular Weight

Approximately 18-25 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zfp629 Protein Vector (Mouse) (pPM-C-HA)
PV249888 500 ng

Zfp629 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Recombinant Asp n 14
A10R53 1 Each

Recombinant Asp n 14

Sign In for Pricing
View Details
Tubb4a Rat Pre-designed siRNA Set A
HY-RS27120 1 Set

Tubb4a Rat Pre-designed siRNA Set A

Sign In for Pricing
View Details
Rod1 Antibody
GWB-MN508D 50 µg

Rod1 Antibody

Sign In for Pricing
View Details
miRZip-122 anti-miR-122 microRNA construct
MZIP122-PA-1 Bacterial Streak

miRZip-122 anti-miR-122 microRNA construct

Sign In for Pricing
View Details
Rabbit Polyclonal SARG Antibody [HRP]
NBP2-97505H 0.1 mL

Rabbit Polyclonal SARG Antibody [HRP]

Sign In for Pricing
View Details