Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-1RA/IL-1RN, Cynomolgus (His)

IL-1RA/IL-1RN mutant proteins are potent anti-inflammatory antagonists of the interleukin 1 family, specifically targeting the proinflammatory cytokines IL1B and IL1A. This mutant variant is designed for enhanced suppressive capacity, tightly protecting the host from immune dysregulation and preventing IL1 from triggering uncontrolled systemic inflammation in response to innate stimulators. IL-1RA/IL-1RN Protein, Cynomolgus (His) is the recombinant cynomolgus-derived IL-1RA/IL-1RN mutant protein, expressed by E. coli , with C-10*His labeled tag.

Product Specifications

Product Name Alternative

IL-1RA/IL-1RN Protein, Cynomolgus (His), Cynomolgus, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-1ra-il-1rn-protein-cynomolgus-his.html

Purity

97.00

Smiles

RPSGRKPSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSKNRKQDKRFAFVRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDKGVMVTKFYFQEDE

Molecular Formula

102126145 (Gene_ID) NP_001270468.1 (R26-E177) (Accession)

Molecular Weight

Approximately 18-25 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Wdr78 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K4526307 1.0 µg DNA

Wdr78 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Rabbit Polyclonal Seasonal H1N1 Hemagglutinin Antibody [Alexa Fluor 647]
NBP2-41106AF647 0.1 mL

Rabbit Polyclonal Seasonal H1N1 Hemagglutinin Antibody [Alexa Fluor 647]

Sign In for Pricing
View Details
Rat Mycoplasma pulmonis IgG,MP IgG ELISA KIT
JOT-EKD0002Ra 96 wells

Rat Mycoplasma pulmonis IgG,MP IgG ELISA KIT

Sign In for Pricing
View Details
Cnot11 (NM_028043) Mouse Tagged Lenti ORF Clone
MR208127L4 10 µg

Cnot11 (NM_028043) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
RAB11FIP2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV623398 1.0 µg DNA

RAB11FIP2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
GDF6, CT (Growth/Differentiation Factor 6, GDF-6, Growth/Differentiation Factor 16, GDF16)
MBS625397-01 0.2 mL

GDF6, CT (Growth/Differentiation Factor 6, GDF-6, Growth/Differentiation Factor 16, GDF16)

Sign In for Pricing
View Details