Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-1RA/IL-1RN, Cynomolgus (His)

IL-1RA/IL-1RN mutant proteins are potent anti-inflammatory antagonists of the interleukin 1 family, specifically targeting the proinflammatory cytokines IL1B and IL1A. This mutant variant is designed for enhanced suppressive capacity, tightly protecting the host from immune dysregulation and preventing IL1 from triggering uncontrolled systemic inflammation in response to innate stimulators. IL-1RA/IL-1RN Protein, Cynomolgus (His) is the recombinant cynomolgus-derived IL-1RA/IL-1RN mutant protein, expressed by E. coli , with C-10*His labeled tag.

Product Specifications

Product Name Alternative

IL-1RA/IL-1RN Protein, Cynomolgus (His), Cynomolgus, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-1ra-il-1rn-protein-cynomolgus-his.html

Purity

97.00

Smiles

RPSGRKPSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSKNRKQDKRFAFVRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDKGVMVTKFYFQEDE

Molecular Formula

102126145 (Gene_ID) NP_001270468.1 (R26-E177) (Accession)

Molecular Weight

Approximately 18-25 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRR11 Mouse Monoclonal Antibody [Clone ID: LBI1C1]
AMM14663VCF 100 µg

PRR11 Mouse Monoclonal Antibody [Clone ID: LBI1C1]

Sign In for Pricing
View Details
Lentiviral mouse Tspan9 shRNA (UAS) - Lentiviral mouse Tspan9 shRNA (UAS, GFP) (100)
GTR15209049 1 Vial

Lentiviral mouse Tspan9 shRNA (UAS) - Lentiviral mouse Tspan9 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
VDAC1 (mVDAC5, OMP2, outer Mitochondrial Membrane Protein porin 1, plasmalemmal porin, porin 31HL, porin 31HM, PORIN, VDAC 5, Voltage-Dependent Anion-selective Channel Protein 1) discontinued
226631-01 50 µL

VDAC1 (mVDAC5, OMP2, outer Mitochondrial Membrane Protein porin 1, plasmalemmal porin, porin 31HL, porin 31HM, PORIN, VDAC 5, Voltage-Dependent Anion-selective Channel Protein 1) discontinued

Sign In for Pricing
View Details
VDAC1 (mVDAC5, OMP2, outer Mitochondrial Membrane Protein porin 1, plasmalemmal porin, porin 31HL, porin 31HM, PORIN, VDAC 5, Voltage-Dependent Anion-selective Channel Protein 1) discontinued
226631-02 100 µL

VDAC1 (mVDAC5, OMP2, outer Mitochondrial Membrane Protein porin 1, plasmalemmal porin, porin 31HL, porin 31HM, PORIN, VDAC 5, Voltage-Dependent Anion-selective Channel Protein 1) discontinued

Sign In for Pricing
View Details
Bovine WD repeat domain 74 ELISA Kit
OM624421 96 Strip Well

Bovine WD repeat domain 74 ELISA Kit

Sign In for Pricing
View Details
Olr1667 3'UTR Luciferase Stable Cell Line
TU214919 1.0 mL

Olr1667 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details