Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-1RA/IL-1RN, Cynomolgus (His)

IL-1RA/IL-1RN mutant proteins are potent anti-inflammatory antagonists of the interleukin 1 family, specifically targeting the proinflammatory cytokines IL1B and IL1A. This mutant variant is designed for enhanced suppressive capacity, tightly protecting the host from immune dysregulation and preventing IL1 from triggering uncontrolled systemic inflammation in response to innate stimulators. IL-1RA/IL-1RN Protein, Cynomolgus (His) is the recombinant cynomolgus-derived IL-1RA/IL-1RN mutant protein, expressed by E. coli , with C-10*His labeled tag.

Product Specifications

Product Name Alternative

IL-1RA/IL-1RN Protein, Cynomolgus (His), Cynomolgus, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-1ra-il-1rn-protein-cynomolgus-his.html

Purity

97.00

Smiles

RPSGRKPSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSKNRKQDKRFAFVRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDKGVMVTKFYFQEDE

Molecular Formula

102126145 (Gene_ID) NP_001270468.1 (R26-E177) (Accession)

Molecular Weight

Approximately 18-25 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal CKAP1 Antibody [Alexa Fluor 750]
NBP3-00264AF750 0.1 mL

Rabbit Polyclonal CKAP1 Antibody [Alexa Fluor 750]

Sign In for Pricing
View Details
Human BTBD9 knockout cell line
ABC-KH1600 1 Vial

Human BTBD9 knockout cell line

Sign In for Pricing
View Details
LETMD1 Rabbit Polyclonal Antibody
TA364828 100 µL

LETMD1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
EFNA3 (Ephrin-A3, EFL-2, EHK1 Ligand, EHK1-L, EPH-related Receptor Tyrosine Kinase Ligand 3, LERK-3, EFL2, EPLG3, LERK3) (MaxLight 550)
MBS6377059-01 0.1 mL

EFNA3 (Ephrin-A3, EFL-2, EHK1 Ligand, EHK1-L, EPH-related Receptor Tyrosine Kinase Ligand 3, LERK-3, EFL2, EPLG3, LERK3) (MaxLight 550)

Sign In for Pricing
View Details
EFNA3 (Ephrin-A3, EFL-2, EHK1 Ligand, EHK1-L, EPH-related Receptor Tyrosine Kinase Ligand 3, LERK-3, EFL2, EPLG3, LERK3) (MaxLight 550)
MBS6377059-02 5x 0.1 mL

EFNA3 (Ephrin-A3, EFL-2, EHK1 Ligand, EHK1-L, EPH-related Receptor Tyrosine Kinase Ligand 3, LERK-3, EFL2, EPLG3, LERK3) (MaxLight 550)

Sign In for Pricing
View Details
Goat anti Human C1 esterase inhibitor
MBS573247-01 1 mL

Goat anti Human C1 esterase inhibitor

Sign In for Pricing
View Details