Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-1RA/IL-1RN, Cynomolgus (His)

IL-1RA/IL-1RN mutant proteins are potent anti-inflammatory antagonists of the interleukin 1 family, specifically targeting the proinflammatory cytokines IL1B and IL1A. This mutant variant is designed for enhanced suppressive capacity, tightly protecting the host from immune dysregulation and preventing IL1 from triggering uncontrolled systemic inflammation in response to innate stimulators. IL-1RA/IL-1RN Protein, Cynomolgus (His) is the recombinant cynomolgus-derived IL-1RA/IL-1RN mutant protein, expressed by E. coli , with C-10*His labeled tag.

Product Specifications

Product Name Alternative

IL-1RA/IL-1RN Protein, Cynomolgus (His), Cynomolgus, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-1ra-il-1rn-protein-cynomolgus-his.html

Purity

97.00

Smiles

RPSGRKPSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSKNRKQDKRFAFVRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDKGVMVTKFYFQEDE

Molecular Formula

102126145 (Gene_ID) NP_001270468.1 (R26-E177) (Accession)

Molecular Weight

Approximately 18-25 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Coq7 ORF Vector (Mouse) (pORF)
ORF041851 1.0 µg DNA

Coq7 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
OSBPL6 (NM_032523) Human Over-expression Lysate
LY410054 100 µg

OSBPL6 (NM_032523) Human Over-expression Lysate

Sign In for Pricing
View Details
Chicken Endothelial differentiation-related factor 1, EDF1 ELISA Kit
MBS9338546 Inquire

Chicken Endothelial differentiation-related factor 1, EDF1 ELISA Kit

Sign In for Pricing
View Details
BeyoGoldTM Screw Cap Sample Tube
FTUB753-1bag 250 PCS/Pack

BeyoGoldTM Screw Cap Sample Tube

Sign In for Pricing
View Details
Recombinant Mouse CXCL10/IP-10 Protein
E901625P 10 µg

Recombinant Mouse CXCL10/IP-10 Protein

Sign In for Pricing
View Details
Human K562 Cell Lysate Membrane Fraction
MBS8413839-01 0.1 mg

Human K562 Cell Lysate Membrane Fraction

Sign In for Pricing
View Details