Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-1RA/IL-1RN, Cynomolgus (His)

IL-1RA/IL-1RN mutant proteins are potent anti-inflammatory antagonists of the interleukin 1 family, specifically targeting the proinflammatory cytokines IL1B and IL1A. This mutant variant is designed for enhanced suppressive capacity, tightly protecting the host from immune dysregulation and preventing IL1 from triggering uncontrolled systemic inflammation in response to innate stimulators. IL-1RA/IL-1RN Protein, Cynomolgus (His) is the recombinant cynomolgus-derived IL-1RA/IL-1RN mutant protein, expressed by E. coli , with C-10*His labeled tag.

Product Specifications

Product Name Alternative

IL-1RA/IL-1RN Protein, Cynomolgus (His), Cynomolgus, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-1ra-il-1rn-protein-cynomolgus-his.html

Purity

97.00

Smiles

RPSGRKPSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSKNRKQDKRFAFVRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDKGVMVTKFYFQEDE

Molecular Formula

102126145 (Gene_ID) NP_001270468.1 (R26-E177) (Accession)

Molecular Weight

Approximately 18-25 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PSAP Recombinant Protein (Rat)
RP222527 100 µg

PSAP Recombinant Protein (Rat)

Sign In for Pricing
View Details
HTT Protein Vector (Mouse) (pPM-C-His)
PV190353 500 ng

HTT Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
ErbB2, NT (ERBB2, HER2, MLN19, NEU, NGL, Receptor tyrosine-protein kinase erbB-2, Metastatic lymph node gene 19 protein, Proto-oncogene Neu, Proto-oncogene c-ErbB-2, Tyrosine kinase-type cell surface receptor HER2, p185erbB2, CD340) (Biotin) discontinued
035161-Biotin 200 µL

ErbB2, NT (ERBB2, HER2, MLN19, NEU, NGL, Receptor tyrosine-protein kinase erbB-2, Metastatic lymph node gene 19 protein, Proto-oncogene Neu, Proto-oncogene c-ErbB-2, Tyrosine kinase-type cell surface receptor HER2, p185erbB2, CD340) (Biotin) discontinued

Sign In for Pricing
View Details
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) CRK40 Polyclonal Antibody
MBS9009799 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) CRK40 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-TNFSF7 / CD27L / CD70 Reference Antibody (Vorsetuzumab mafodotin)
M02853-2 100 µg

Anti-TNFSF7 / CD27L / CD70 Reference Antibody (Vorsetuzumab mafodotin)

Sign In for Pricing
View Details
Recombinant Human Papillomavirus 11 (HPV 11)
PT_73613-01 100 µg

Recombinant Human Papillomavirus 11 (HPV 11)

Sign In for Pricing
View Details