Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-1RA/IL-1RN, Cynomolgus (His)

IL-1RA/IL-1RN mutant proteins are potent anti-inflammatory antagonists of the interleukin 1 family, specifically targeting the proinflammatory cytokines IL1B and IL1A. This mutant variant is designed for enhanced suppressive capacity, tightly protecting the host from immune dysregulation and preventing IL1 from triggering uncontrolled systemic inflammation in response to innate stimulators. IL-1RA/IL-1RN Protein, Cynomolgus (His) is the recombinant cynomolgus-derived IL-1RA/IL-1RN mutant protein, expressed by E. coli , with C-10*His labeled tag.

Product Specifications

Product Name Alternative

IL-1RA/IL-1RN Protein, Cynomolgus (His), Cynomolgus, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-1ra-il-1rn-protein-cynomolgus-his.html

Purity

97.00

Smiles

RPSGRKPSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSKNRKQDKRFAFVRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDKGVMVTKFYFQEDE

Molecular Formula

102126145 (Gene_ID) NP_001270468.1 (R26-E177) (Accession)

Molecular Weight

Approximately 18-25 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRSS8 Polyclonal Antibody, PE-Cy5.5 Conjugated
bs-6064R-PE-Cy5.5 100 µL

PRSS8 Polyclonal Antibody, PE-Cy5.5 Conjugated

Sign In for Pricing
View Details
Human Phospho-ErbB2/Her2 (Y1248) Affinity Purified PAb
AF1768-SP 25 µg

Human Phospho-ErbB2/Her2 (Y1248) Affinity Purified PAb

Sign In for Pricing
View Details
MCF2L (DRG, KIAA0861, Probable Guanine Nucleotide Exchange Factor MCF2L2, Dbs-related Rho Family Guanine Nucleotide Exchange Factor, MCF2-transforming Sequence-like Protein 2) (MaxLight 550)
MBS6212465-01 0.1 mL

MCF2L (DRG, KIAA0861, Probable Guanine Nucleotide Exchange Factor MCF2L2, Dbs-related Rho Family Guanine Nucleotide Exchange Factor, MCF2-transforming Sequence-like Protein 2) (MaxLight 550)

Sign In for Pricing
View Details
MCF2L (DRG, KIAA0861, Probable Guanine Nucleotide Exchange Factor MCF2L2, Dbs-related Rho Family Guanine Nucleotide Exchange Factor, MCF2-transforming Sequence-like Protein 2) (MaxLight 550)
MBS6212465-02 5x 0.1 mL

MCF2L (DRG, KIAA0861, Probable Guanine Nucleotide Exchange Factor MCF2L2, Dbs-related Rho Family Guanine Nucleotide Exchange Factor, MCF2-transforming Sequence-like Protein 2) (MaxLight 550)

Sign In for Pricing
View Details
Micro Plate Immulon 4HBX 96well
X19735 50 / PCK

Micro Plate Immulon 4HBX 96well

Sign In for Pricing
View Details
Human Acyl-coenzyme A synthetase ACSM4, mitochondrial (ACSM4) ELISA Kit
MBS7253764-01 48 Well

Human Acyl-coenzyme A synthetase ACSM4, mitochondrial (ACSM4) ELISA Kit

Sign In for Pricing
View Details