Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-1RA/IL-1RN, Cynomolgus (His)

IL-1RA/IL-1RN mutant proteins are potent anti-inflammatory antagonists of the interleukin 1 family, specifically targeting the proinflammatory cytokines IL1B and IL1A. This mutant variant is designed for enhanced suppressive capacity, tightly protecting the host from immune dysregulation and preventing IL1 from triggering uncontrolled systemic inflammation in response to innate stimulators. IL-1RA/IL-1RN Protein, Cynomolgus (His) is the recombinant cynomolgus-derived IL-1RA/IL-1RN mutant protein, expressed by E. coli , with C-10*His labeled tag.

Product Specifications

Product Name Alternative

IL-1RA/IL-1RN Protein, Cynomolgus (His), Cynomolgus, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-1ra-il-1rn-protein-cynomolgus-his.html

Purity

97.00

Smiles

RPSGRKPSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSKNRKQDKRFAFVRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDKGVMVTKFYFQEDE

Molecular Formula

102126145 (Gene_ID) NP_001270468.1 (R26-E177) (Accession)

Molecular Weight

Approximately 18-25 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Angular rotor
E2759 1 Unit

Angular rotor

Sign In for Pricing
View Details
Gasdermin Double Nickase Plasmid (h)
sc-410658-NIC 20 µg

Gasdermin Double Nickase Plasmid (h)

Sign In for Pricing
View Details
IFNAR2 goat polyclonal antibody, Purified
AP22577PU-N 50 µg

IFNAR2 goat polyclonal antibody, Purified

Sign In for Pricing
View Details
Rabl5 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K7236708 1.0 µg DNA

Rabl5 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Adenosine Receptor A2a (ADORA2A) Rabbit Polyclonal Antibody
TA373311 100 µL

Adenosine Receptor A2a (ADORA2A) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ITGB6 Protein Vector (Mouse) (pPB-N-His)
PV192655 500 ng

ITGB6 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details