Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-1RA/IL-1RN, Cynomolgus (His)

IL-1RA/IL-1RN mutant proteins are potent anti-inflammatory antagonists of the interleukin 1 family, specifically targeting the proinflammatory cytokines IL1B and IL1A. This mutant variant is designed for enhanced suppressive capacity, tightly protecting the host from immune dysregulation and preventing IL1 from triggering uncontrolled systemic inflammation in response to innate stimulators. IL-1RA/IL-1RN Protein, Cynomolgus (His) is the recombinant cynomolgus-derived IL-1RA/IL-1RN mutant protein, expressed by E. coli , with C-10*His labeled tag.

Product Specifications

Product Name Alternative

IL-1RA/IL-1RN Protein, Cynomolgus (His), Cynomolgus, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-1ra-il-1rn-protein-cynomolgus-his.html

Purity

97.00

Smiles

RPSGRKPSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSKNRKQDKRFAFVRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDKGVMVTKFYFQEDE

Molecular Formula

102126145 (Gene_ID) NP_001270468.1 (R26-E177) (Accession)

Molecular Weight

Approximately 18-25 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SDHD sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K2109607 1.0 µg DNA

SDHD sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
DYRK1B (Dual Specificity Tyrosine-phosphorylation-regulated Kinase 1B, Minibrain-related Kinase, Mirk Protein Kinase, MIRK) (Biotin)
126098-Biotin 100 µL

DYRK1B (Dual Specificity Tyrosine-phosphorylation-regulated Kinase 1B, Minibrain-related Kinase, Mirk Protein Kinase, MIRK) (Biotin)

Sign In for Pricing
View Details
IDO1/2-IN-1 hydrochloride
MBS5806319 Inquire

IDO1/2-IN-1 hydrochloride

Sign In for Pricing
View Details
Rbks 3'UTR Luciferase Stable Cell Line
TU217365 1.0 mL

Rbks 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
ML161
2689-5 5 mg

ML161

Sign In for Pricing
View Details
SAAL1-set siRNA/shRNA/RNAi Lentivector (Human)
42966091 4x 500 ng

SAAL1-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details