Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-15 receptor subunit alpha (IL15RA), partial (Active)

Product Specifications

Product Name Alternative

IL-15 receptor subunit alpha; IL-15R-alpha; IL-15RA

Abbreviation

Recombinant Human IL15RA protein, partial (Active)

Gene Name

IL15RA

UniProt

Q13261

Expression Region

31-205aa

Organism

Homo sapiens (Human)

Target Sequence

ITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIRDPALVHQRPAPPSTVTTAGVTPQPESLSPSGKEPAASSPSSNNTAATTAAIVPGSQLMPSKSPSTGTTEISSHESSHGTPSQTTAKNWELTASASHQPPGVYPQGHSDTT

Tag

C-terminal 10xHis-tagged

Type

Active Protein & In Stock Protein

Source

Mammalian cell

Field of Research

Others

Relevance

High-affinity receptor for interleukin-15. Can signal both in cis and trans where IL15R from one subset of cells presents IL15 to neighboring IL2RG-expressing cells. In neutrophils, binds and activates kinase SYK in response to IL15 stimulation. In neutrophils, required for IL15-induced phagocytosis in a SYK-dependent manner. Expression of different isoforms may alter or interfere with signal transduction.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Human IL15RA at 2 μg/mL can bind Human IL15 (CSB-MP011593HU) .The EC50 is 32.53-38.41 ng/mL.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

19.9 kDa

References & Citations

Complete sequencing and characterization of 21,243 full-length human cDNAs. Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Sugano S. Nat. Genet. 36:40-45 (2004)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

L-Dihydroorotic acid
TRC-D451530-250MG 250 mg

L-Dihydroorotic acid

Sign In for Pricing
View Details
GNB3 (NM_002075) Human Over-expression Lysate
LC400761 20 µg

GNB3 (NM_002075) Human Over-expression Lysate

Sign In for Pricing
View Details
Hemopexin (HPX) Rabbit Polyclonal Antibody
TA360978 100 µL

Hemopexin (HPX) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Serf2 Mouse Gene Knockout Kit (CRISPR)
KN515543 1 Kit

Serf2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Wnt5a Mouse Gene Knockout Kit (CRISPR)
KN319455RB 1 Kit

Wnt5a Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
P2RX4 (NM_002560) Human Over-expression Lysate
LC419264 20 µg

P2RX4 (NM_002560) Human Over-expression Lysate

Sign In for Pricing
View Details