Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Larimichthys crocea Odorant receptor

Product Specifications

Abbreviation

Recombinant Larimichthys crocea Odorant receptor protein

UniProt

F2XEX3

Expression Region

1-308aa

Organism

Larimichthys crocea (Large yellow croaker) (Pseudosciaena crocea)

Target Sequence

MMDNVSKLTIFTLSGLHEIANYRVTLFVLTLLCYCVIWLINLAIIVTIIMDKSLHEPMYIFLCNLCINGLYETAGFYPKFLIDLLSTFHVISYAGCLLQGFVLHSSACADFSILVLMAYDRYVAICRPLVYHSVMTTQRVCVFIFFAWLIPLYLVFMSSITTARSRLCGSHIPKIYCINFLVGKLACTTSIANVIIPAFNYTFYFLHVMFIAWSYMYLIRKCLISSENRSKFMQTCLPHLICLIIVVVSLLFDLLYMRFGSQTLSQNVKNFMAMEFLLVPPIINPLIYGFKLTQIRNRIIQFLSGKRI

Tag

N-terminal 10xHis-tagged

Type

CF Transmembrane Protein & In Stock Protein

Source

In vitro E.coli expression system

Field of Research

Epigenetics and Nuclear Signaling

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

37.0 kDa

References & Citations

"Family structure and phylogenetic analysis of odorant receptor genes in the large yellow croaker (Larimichthys crocea) ." Zhou Y., Yan X., Xu S., Zhu P., He X., Liu J. BMC Evol. Biol. 11:237-237 (2011)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IRF3 (NM_001197124) Human Over-expression Lysate
LC434143 20 µg

IRF3 (NM_001197124) Human Over-expression Lysate

Sign In for Pricing
View Details
PARP Antibody (phospho-S177)
F48726-0.08ML 0.08 mL

PARP Antibody (phospho-S177)

Sign In for Pricing
View Details
EIF4A2 Polyclonal Antibody
E-AB-53065-01 20 µL

EIF4A2 Polyclonal Antibody

Sign In for Pricing
View Details
EIF4A2 Polyclonal Antibody
E-AB-53065-02 60 µL

EIF4A2 Polyclonal Antibody

Sign In for Pricing
View Details
EIF4A2 Polyclonal Antibody
E-AB-53065-03 120 µL

EIF4A2 Polyclonal Antibody

Sign In for Pricing
View Details
EIF4A2 Polyclonal Antibody
E-AB-53065-04 200 µL

EIF4A2 Polyclonal Antibody

Sign In for Pricing
View Details