Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-10, Mouse (His)

IL-10 protein is a key immunomodulator that, by binding to its heterotetrameric receptors (IL10RA and IL10RB), activates JAK1 and STAT2 (the latter phosphorylates STAT3), thereby triggering potent anti-inflammatory effects. Phosphorylated STAT3 translocates to the nucleus and promotes the expression of anti-inflammatory mediators. Animal-Free IL-10 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-10 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-10 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-10-protein-mouse-his.html

Purity

95.0

Smiles

MSRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQLDNILLTDSLMQDFKGYLGCQALSEMIQFYLVEVMPQAEKHGPEIKEHLNSLGEKLKTLRMRLRRCHRFLPCENKSKAVEQVKSDFNKLQDQGVYKAMNEFDIFINCIEAYMMIKMKS

Molecular Formula

16153 (Gene_ID) P18893 (S19-S178) (Accession)

Molecular Weight

Approximately 19 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human METRN (Meteorin) ELISA Kit
EK242654 96 Well

Human METRN (Meteorin) ELISA Kit

Sign In for Pricing
View Details
PerCP anti-human CD161
GT11555 25 Tests

PerCP anti-human CD161

Sign In for Pricing
View Details
RAB3A, NT (RAB3A, Ras-related protein Rab-3A) (PE) discontinued
040763-PE 200 µL

RAB3A, NT (RAB3A, Ras-related protein Rab-3A) (PE) discontinued

Sign In for Pricing
View Details
β -Nicotinamide Adenine Dinucleotide Phosphate Trihydrate
41490012-3 5 g

β -Nicotinamide Adenine Dinucleotide Phosphate Trihydrate

Sign In for Pricing
View Details
CD8A, CT (T-cell Surface Glycoprotein CD8 alpha Chain, T-lymphocyte Differentiation Antigen T8/Leu-2, MAL)
MBS6013046-01 0.05 mg

CD8A, CT (T-cell Surface Glycoprotein CD8 alpha Chain, T-lymphocyte Differentiation Antigen T8/Leu-2, MAL)

Sign In for Pricing
View Details
CD8A, CT (T-cell Surface Glycoprotein CD8 alpha Chain, T-lymphocyte Differentiation Antigen T8/Leu-2, MAL)
MBS6013046-02 5x 0.05 mg

CD8A, CT (T-cell Surface Glycoprotein CD8 alpha Chain, T-lymphocyte Differentiation Antigen T8/Leu-2, MAL)

Sign In for Pricing
View Details