Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-10, Mouse (His)

IL-10 protein is a key immunomodulator that, by binding to its heterotetrameric receptors (IL10RA and IL10RB), activates JAK1 and STAT2 (the latter phosphorylates STAT3), thereby triggering potent anti-inflammatory effects. Phosphorylated STAT3 translocates to the nucleus and promotes the expression of anti-inflammatory mediators. Animal-Free IL-10 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-10 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-10 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-10-protein-mouse-his.html

Purity

95.0

Smiles

MSRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQLDNILLTDSLMQDFKGYLGCQALSEMIQFYLVEVMPQAEKHGPEIKEHLNSLGEKLKTLRMRLRRCHRFLPCENKSKAVEQVKSDFNKLQDQGVYKAMNEFDIFINCIEAYMMIKMKS

Molecular Formula

16153 (Gene_ID) P18893 (S19-S178) (Accession)

Molecular Weight

Approximately 19 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDE9A (NM_001001574) Human Over-expression Lysate
LH03160V 100 µg

PDE9A (NM_001001574) Human Over-expression Lysate

Sign In for Pricing
View Details
Kinetochore protein Nuf2 (NUF2) Rat ELISA Kit
E5485 96 Tests

Kinetochore protein Nuf2 (NUF2) Rat ELISA Kit

Sign In for Pricing
View Details
NUDT1 (7,8-dihydro-8-oxoguanine Triphosphatase, 2-hydroxy-dATP Diphosphatase, 8-oxo-dGTPase, Nucleoside Diphosphate-linked Moiety X Motif 1, Nudix Motif 1, MTH1)
MBS6000190-01 0.1 mg

NUDT1 (7,8-dihydro-8-oxoguanine Triphosphatase, 2-hydroxy-dATP Diphosphatase, 8-oxo-dGTPase, Nucleoside Diphosphate-linked Moiety X Motif 1, Nudix Motif 1, MTH1)

Sign In for Pricing
View Details
NUDT1 (7,8-dihydro-8-oxoguanine Triphosphatase, 2-hydroxy-dATP Diphosphatase, 8-oxo-dGTPase, Nucleoside Diphosphate-linked Moiety X Motif 1, Nudix Motif 1, MTH1)
MBS6000190-02 5x 0.1 mg

NUDT1 (7,8-dihydro-8-oxoguanine Triphosphatase, 2-hydroxy-dATP Diphosphatase, 8-oxo-dGTPase, Nucleoside Diphosphate-linked Moiety X Motif 1, Nudix Motif 1, MTH1)

Sign In for Pricing
View Details
WDR62 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K2634008 1.0 µg DNA

WDR62 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Recombinant Calcitonin Gene Related Peptide (CGRP)
MBS2009016-01 0.01 mg

Recombinant Calcitonin Gene Related Peptide (CGRP)

Sign In for Pricing
View Details