Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-10, Mouse (His)

IL-10 protein is a key immunomodulator that, by binding to its heterotetrameric receptors (IL10RA and IL10RB), activates JAK1 and STAT2 (the latter phosphorylates STAT3), thereby triggering potent anti-inflammatory effects. Phosphorylated STAT3 translocates to the nucleus and promotes the expression of anti-inflammatory mediators. Animal-Free IL-10 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-10 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-10 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-10-protein-mouse-his.html

Purity

95.0

Smiles

MSRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQLDNILLTDSLMQDFKGYLGCQALSEMIQFYLVEVMPQAEKHGPEIKEHLNSLGEKLKTLRMRLRRCHRFLPCENKSKAVEQVKSDFNKLQDQGVYKAMNEFDIFINCIEAYMMIKMKS

Molecular Formula

16153 (Gene_ID) P18893 (S19-S178) (Accession)

Molecular Weight

Approximately 19 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDE6A Overexpression Lysate (Native) - (Dry Ice)
NBL1-14226 0.1 mg

PDE6A Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details
Isoprene
S-2300 1 mL

Isoprene

Sign In for Pricing
View Details
STK11, NT (I29) (Serine/Threonine-protein Kinase 11, Serine/Threonine-protein Kinase LKB1, Renal Carcinoma Antigen NY-REN-19, LKB1, PJS) (PE) discontinued
S7973-58Y5-PE 200 µL

STK11, NT (I29) (Serine/Threonine-protein Kinase 11, Serine/Threonine-protein Kinase LKB1, Renal Carcinoma Antigen NY-REN-19, LKB1, PJS) (PE) discontinued

Sign In for Pricing
View Details
PGRMC1 Antibody
MBS8503580-01 0.1 mg

PGRMC1 Antibody

Sign In for Pricing
View Details
PGRMC1 Antibody
MBS8503580-02 0.1 mL (AF405L)

PGRMC1 Antibody

Sign In for Pricing
View Details
PGRMC1 Antibody
MBS8503580-03 0.1 mL (AF405S)

PGRMC1 Antibody

Sign In for Pricing
View Details