Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-10, Mouse (His)

IL-10 protein is a key immunomodulator that, by binding to its heterotetrameric receptors (IL10RA and IL10RB), activates JAK1 and STAT2 (the latter phosphorylates STAT3), thereby triggering potent anti-inflammatory effects. Phosphorylated STAT3 translocates to the nucleus and promotes the expression of anti-inflammatory mediators. Animal-Free IL-10 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-10 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-10 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-10-protein-mouse-his.html

Purity

95.0

Smiles

MSRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQLDNILLTDSLMQDFKGYLGCQALSEMIQFYLVEVMPQAEKHGPEIKEHLNSLGEKLKTLRMRLRRCHRFLPCENKSKAVEQVKSDFNKLQDQGVYKAMNEFDIFINCIEAYMMIKMKS

Molecular Formula

16153 (Gene_ID) P18893 (S19-S178) (Accession)

Molecular Weight

Approximately 19 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ENY2 CRISPR/Cas9 KO Plasmid (m)
sc-432372 20 µg

ENY2 CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details
HOXA1 (Homeobox Protein Hox-A1, Homeobox Protein Hox-1F, HOX1F, MGC45232) (MaxLight 650)
MBS6222605-01 0.1 mL

HOXA1 (Homeobox Protein Hox-A1, Homeobox Protein Hox-1F, HOX1F, MGC45232) (MaxLight 650)

Sign In for Pricing
View Details
HOXA1 (Homeobox Protein Hox-A1, Homeobox Protein Hox-1F, HOX1F, MGC45232) (MaxLight 650)
MBS6222605-02 5x 0.1 mL

HOXA1 (Homeobox Protein Hox-A1, Homeobox Protein Hox-1F, HOX1F, MGC45232) (MaxLight 650)

Sign In for Pricing
View Details
C1orf103 Protein Vector (Human) (pPB-N-His)
PV005538 500 ng

C1orf103 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Rabbit Polyclonal SPG8 Antibody [Alexa Fluor 405]
NBP2-82036AF405 0.1 mL

Rabbit Polyclonal SPG8 Antibody [Alexa Fluor 405]

Sign In for Pricing
View Details
Lentiviral human LIAS shRNA (UAS) - Lentiviral human LIAS shRNA (UAS, iRFP) (100)
GTR15148023 1 Vial

Lentiviral human LIAS shRNA (UAS) - Lentiviral human LIAS shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details