Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-10, Mouse (His)

IL-10 protein is a key immunomodulator that, by binding to its heterotetrameric receptors (IL10RA and IL10RB), activates JAK1 and STAT2 (the latter phosphorylates STAT3), thereby triggering potent anti-inflammatory effects. Phosphorylated STAT3 translocates to the nucleus and promotes the expression of anti-inflammatory mediators. Animal-Free IL-10 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-10 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-10 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-10-protein-mouse-his.html

Purity

95.0

Smiles

MSRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQLDNILLTDSLMQDFKGYLGCQALSEMIQFYLVEVMPQAEKHGPEIKEHLNSLGEKLKTLRMRLRRCHRFLPCENKSKAVEQVKSDFNKLQDQGVYKAMNEFDIFINCIEAYMMIKMKS

Molecular Formula

16153 (Gene_ID) P18893 (S19-S178) (Accession)

Molecular Weight

Approximately 19 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Biotin-Linked Monoclonal Antibody to Sialic Acid Binding Ig Like Lectin 7 (SIGLEC7)
MBS2144720-01 0.1 mL

Biotin-Linked Monoclonal Antibody to Sialic Acid Binding Ig Like Lectin 7 (SIGLEC7)

Sign In for Pricing
View Details
Biotin-Linked Monoclonal Antibody to Sialic Acid Binding Ig Like Lectin 7 (SIGLEC7)
MBS2144720-02 0.2 mL

Biotin-Linked Monoclonal Antibody to Sialic Acid Binding Ig Like Lectin 7 (SIGLEC7)

Sign In for Pricing
View Details
Biotin-Linked Monoclonal Antibody to Sialic Acid Binding Ig Like Lectin 7 (SIGLEC7)
MBS2144720-03 0.5 mL

Biotin-Linked Monoclonal Antibody to Sialic Acid Binding Ig Like Lectin 7 (SIGLEC7)

Sign In for Pricing
View Details
Biotin-Linked Monoclonal Antibody to Sialic Acid Binding Ig Like Lectin 7 (SIGLEC7)
MBS2144720-04 1 mL

Biotin-Linked Monoclonal Antibody to Sialic Acid Binding Ig Like Lectin 7 (SIGLEC7)

Sign In for Pricing
View Details
Biotin-Linked Monoclonal Antibody to Sialic Acid Binding Ig Like Lectin 7 (SIGLEC7)
MBS2144720-05 5 mL

Biotin-Linked Monoclonal Antibody to Sialic Acid Binding Ig Like Lectin 7 (SIGLEC7)

Sign In for Pricing
View Details
Biotin-Linked Monoclonal Antibody to Sialic Acid Binding Ig Like Lectin 7 (SIGLEC7)
MBS2144720-06 5x 5 mL

Biotin-Linked Monoclonal Antibody to Sialic Acid Binding Ig Like Lectin 7 (SIGLEC7)

Sign In for Pricing
View Details