Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-10, Mouse (His)

IL-10 protein is a key immunomodulator that, by binding to its heterotetrameric receptors (IL10RA and IL10RB), activates JAK1 and STAT2 (the latter phosphorylates STAT3), thereby triggering potent anti-inflammatory effects. Phosphorylated STAT3 translocates to the nucleus and promotes the expression of anti-inflammatory mediators. Animal-Free IL-10 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-10 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-10 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-10-protein-mouse-his.html

Purity

95.0

Smiles

MSRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQLDNILLTDSLMQDFKGYLGCQALSEMIQFYLVEVMPQAEKHGPEIKEHLNSLGEKLKTLRMRLRRCHRFLPCENKSKAVEQVKSDFNKLQDQGVYKAMNEFDIFINCIEAYMMIKMKS

Molecular Formula

16153 (Gene_ID) P18893 (S19-S178) (Accession)

Molecular Weight

Approximately 19 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Twsg1 3'UTR GFP Stable Cell Line
TU171390 1.0 mL

Twsg1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
CASC4, CT (CASC4, Protein CASC4, Cancer susceptibility candidate gene 4 protein) (MaxLight 650)
MBS6280845-01 0.1 mL

CASC4, CT (CASC4, Protein CASC4, Cancer susceptibility candidate gene 4 protein) (MaxLight 650)

Sign In for Pricing
View Details
CASC4, CT (CASC4, Protein CASC4, Cancer susceptibility candidate gene 4 protein) (MaxLight 650)
MBS6280845-02 5x 0.1 mL

CASC4, CT (CASC4, Protein CASC4, Cancer susceptibility candidate gene 4 protein) (MaxLight 650)

Sign In for Pricing
View Details
Tanezumab
abx831119-01 100 µg

Tanezumab

Sign In for Pricing
View Details
Tanezumab
abx831119-02 1 mg

Tanezumab

Sign In for Pricing
View Details
KY Human Pre-designed siRNA Set A
HY-RS07479 1 Set

KY Human Pre-designed siRNA Set A

Sign In for Pricing
View Details