Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-10, Mouse (His)

IL-10 protein is a key immunomodulator that, by binding to its heterotetrameric receptors (IL10RA and IL10RB), activates JAK1 and STAT2 (the latter phosphorylates STAT3), thereby triggering potent anti-inflammatory effects. Phosphorylated STAT3 translocates to the nucleus and promotes the expression of anti-inflammatory mediators. Animal-Free IL-10 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-10 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-10 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-10-protein-mouse-his.html

Purity

95.0

Smiles

MSRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQLDNILLTDSLMQDFKGYLGCQALSEMIQFYLVEVMPQAEKHGPEIKEHLNSLGEKLKTLRMRLRRCHRFLPCENKSKAVEQVKSDFNKLQDQGVYKAMNEFDIFINCIEAYMMIKMKS

Molecular Formula

16153 (Gene_ID) P18893 (S19-S178) (Accession)

Molecular Weight

Approximately 19 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Emc4 Mouse shRNA Lentiviral Particle (Locus ID 68032)
TL510082V 500 µL Each

Emc4 Mouse shRNA Lentiviral Particle (Locus ID 68032)

Sign In for Pricing
View Details
LAP2 Antibody / Thymopoietin
F53801-0.05ML 0.05 mL

LAP2 Antibody / Thymopoietin

Sign In for Pricing
View Details
PSMB2 Antibody
ABD7365 100 µg

PSMB2 Antibody

Sign In for Pricing
View Details
DSPC-d13
HY-W040193S6 1 mg

DSPC-d13

Sign In for Pricing
View Details
PE/Cyanine7 anti-human CD28
GT15742 100 Tests

PE/Cyanine7 anti-human CD28

Sign In for Pricing
View Details
SARS-CoV-2 (2019-nCoV) Spike RBD Antibody, Mouse PAb
MBS8119550-01 0.02 mL

SARS-CoV-2 (2019-nCoV) Spike RBD Antibody, Mouse PAb

Sign In for Pricing
View Details