Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-10, Mouse (His)

IL-10 protein is a key immunomodulator that, by binding to its heterotetrameric receptors (IL10RA and IL10RB), activates JAK1 and STAT2 (the latter phosphorylates STAT3), thereby triggering potent anti-inflammatory effects. Phosphorylated STAT3 translocates to the nucleus and promotes the expression of anti-inflammatory mediators. Animal-Free IL-10 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-10 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-10 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-10-protein-mouse-his.html

Purity

95.0

Smiles

MSRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQLDNILLTDSLMQDFKGYLGCQALSEMIQFYLVEVMPQAEKHGPEIKEHLNSLGEKLKTLRMRLRRCHRFLPCENKSKAVEQVKSDFNKLQDQGVYKAMNEFDIFINCIEAYMMIKMKS

Molecular Formula

16153 (Gene_ID) P18893 (S19-S178) (Accession)

Molecular Weight

Approximately 19 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

BMIQ3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV719735 1.0 µg DNA

BMIQ3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Methyltetrazine-amine HCl salt
MBS5756601 Inquire

Methyltetrazine-amine HCl salt

Sign In for Pricing
View Details
RNASE4 Recombinant Protein (Human)
RP026524 100 µg

RNASE4 Recombinant Protein (Human)

Sign In for Pricing
View Details
RRN3 (TIFIA, RNA polymerase I-specific transcription initiation factor RRN3, Transcription initiation factor IA) (MaxLight 490) discontinued
132854-ML490 100 µL

RRN3 (TIFIA, RNA polymerase I-specific transcription initiation factor RRN3, Transcription initiation factor IA) (MaxLight 490) discontinued

Sign In for Pricing
View Details
Frozen Tissue Blocks, Colon
CB537582 1 Block

Frozen Tissue Blocks, Colon

Sign In for Pricing
View Details
ICAM2 Antibody
MBS7118360-01 0.05 mg

ICAM2 Antibody

Sign In for Pricing
View Details