Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-10, Mouse (His)

IL-10 protein is a key immunomodulator that, by binding to its heterotetrameric receptors (IL10RA and IL10RB), activates JAK1 and STAT2 (the latter phosphorylates STAT3), thereby triggering potent anti-inflammatory effects. Phosphorylated STAT3 translocates to the nucleus and promotes the expression of anti-inflammatory mediators. Animal-Free IL-10 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-10 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-10 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-10-protein-mouse-his.html

Purity

95.0

Smiles

MSRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQLDNILLTDSLMQDFKGYLGCQALSEMIQFYLVEVMPQAEKHGPEIKEHLNSLGEKLKTLRMRLRRCHRFLPCENKSKAVEQVKSDFNKLQDQGVYKAMNEFDIFINCIEAYMMIKMKS

Molecular Formula

16153 (Gene_ID) P18893 (S19-S178) (Accession)

Molecular Weight

Approximately 19 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal MRP1 Antibody (IU2H10) [CoraFluor 1]
NB400-156CL1 0.1 mL

Mouse Monoclonal MRP1 Antibody (IU2H10) [CoraFluor 1]

Sign In for Pricing
View Details
Human Cluster Of Differentiation 73 (CD73) ELISA Kit
JL14312-01 48 Tests

Human Cluster Of Differentiation 73 (CD73) ELISA Kit

Sign In for Pricing
View Details
Human Cluster Of Differentiation 73 (CD73) ELISA Kit
JL14312-02 96 Tests

Human Cluster Of Differentiation 73 (CD73) ELISA Kit

Sign In for Pricing
View Details
PHF16 (JADE3) Rabbit Polyclonal Antibody
TA356023 100 µL

PHF16 (JADE3) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SLC25A40 AAV Vector (Human) (CMV)
44030101 1 µg

SLC25A40 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
EGFR (phospho Tyr1110) Polyclonal Antibody
UB-GEN-12779 100 µL

EGFR (phospho Tyr1110) Polyclonal Antibody

Sign In for Pricing
View Details