Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-10, Mouse (His)

IL-10 protein is a key immunomodulator that, by binding to its heterotetrameric receptors (IL10RA and IL10RB), activates JAK1 and STAT2 (the latter phosphorylates STAT3), thereby triggering potent anti-inflammatory effects. Phosphorylated STAT3 translocates to the nucleus and promotes the expression of anti-inflammatory mediators. Animal-Free IL-10 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-10 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-10 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-10-protein-mouse-his.html

Purity

95.0

Smiles

MSRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQLDNILLTDSLMQDFKGYLGCQALSEMIQFYLVEVMPQAEKHGPEIKEHLNSLGEKLKTLRMRLRRCHRFLPCENKSKAVEQVKSDFNKLQDQGVYKAMNEFDIFINCIEAYMMIKMKS

Molecular Formula

16153 (Gene_ID) P18893 (S19-S178) (Accession)

Molecular Weight

Approximately 19 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Islet Amyloid Polypeptide (IAPP) Antibody
abx230384 100 µg

Islet Amyloid Polypeptide (IAPP) Antibody

Sign In for Pricing
View Details
IgM Antibody
GWB-6A1F27 1 mg

IgM Antibody

Sign In for Pricing
View Details
Pentachlorothioanisole
TRC-P238170-10G 10 g

Pentachlorothioanisole

Sign In for Pricing
View Details
USF2 (Upstream Stimulatory Factor 2, Class B Basic Helix-loop-helix Protein 12, bHLHb12, FOS-interacting Protein, FIP, Major Late Transcription Factor 2, Upstream Transcription Factor 2) (FITC)
135142-FITC 100 µL

USF2 (Upstream Stimulatory Factor 2, Class B Basic Helix-loop-helix Protein 12, bHLHb12, FOS-interacting Protein, FIP, Major Late Transcription Factor 2, Upstream Transcription Factor 2) (FITC)

Sign In for Pricing
View Details
Cytochrome C Recombinant Antibody, FITC Conjugated
bsm-52050R-FITC-01 20 µL

Cytochrome C Recombinant Antibody, FITC Conjugated

Sign In for Pricing
View Details
Cytochrome C Recombinant Antibody, FITC Conjugated
bsm-52050R-FITC-02 100 µL

Cytochrome C Recombinant Antibody, FITC Conjugated

Sign In for Pricing
View Details