Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HB-EGF, Human (sf9)

HB-EGF protein is a multifunctional growth factor that is regulated through EGFR, ERBB2 and ERBB4 and is critical for cardiac valve formation and cardiac function. It promotes smooth muscle cell proliferation and may contribute to macrophage-mediated cell proliferation. HB-EGF Protein, Human (sf9) is the recombinant human-derived HB-EGF protein, expressed by Sf9 insect cells , with tag free.

Product Specifications

Product Name Alternative

HB-EGF Protein, Human (sf9), Human, Sf9 insect cells

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hb-egf-protein-human-sf9.html

Smiles

MKLLPSVVLKLFLAAVLSALVTGESLERLRRGLAAGTSNPDPPTVSTDQLLPLGGGRDRKVRDLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHGERCHGLSL

Molecular Formula

1839 (Gene_ID) Q99075 (D63-L148) (Accession)

Molecular Weight

Approximately 16.4 kDa

Shipping Conditions

Dry ice.

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse Malignant T cell-amplified sequence 1, MCTS1 ELISA Kit
MBS9323994-01 48 Well

Mouse Malignant T cell-amplified sequence 1, MCTS1 ELISA Kit

Ask
View Details
Mouse Malignant T cell-amplified sequence 1, MCTS1 ELISA Kit
MBS9323994-02 96 Well

Mouse Malignant T cell-amplified sequence 1, MCTS1 ELISA Kit

Ask
View Details
Mouse Malignant T cell-amplified sequence 1, MCTS1 ELISA Kit
MBS9323994-03 5x 96 Well

Mouse Malignant T cell-amplified sequence 1, MCTS1 ELISA Kit

Ask
View Details
Mouse Malignant T cell-amplified sequence 1, MCTS1 ELISA Kit
MBS9323994-04 10x 96 Well

Mouse Malignant T cell-amplified sequence 1, MCTS1 ELISA Kit

Ask
View Details
BEX1 Over-expression Lysate Product
GWB-5F8CB2 0.1 mg

BEX1 Over-expression Lysate Product

Ask
View Details
Homer (1b+1c) Rabbit pAb
E47R17352 100 µL

Homer (1b+1c) Rabbit pAb

Ask
View Details