HB-EGF, Human (sf9)
HB-EGF protein is a multifunctional growth factor that is regulated through EGFR, ERBB2 and ERBB4 and is critical for cardiac valve formation and cardiac function. It promotes smooth muscle cell proliferation and may contribute to macrophage-mediated cell proliferation. HB-EGF Protein, Human (sf9) is the recombinant human-derived HB-EGF protein, expressed by Sf9 insect cells , with tag free.
Product Specifications
Product Name Alternative
HB-EGF Protein, Human (sf9), Human, Sf9 insect cells
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/hb-egf-protein-human-sf9.html
Smiles
MKLLPSVVLKLFLAAVLSALVTGESLERLRRGLAAGTSNPDPPTVSTDQLLPLGGGRDRKVRDLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHGERCHGLSL
Molecular Formula
1839 (Gene_ID) Q99075 (D63-L148) (Accession)
Molecular Weight
Approximately 16.4 kDa
Shipping Conditions
Dry ice.
Scientific Category
Recombinant Proteins
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
RLIM (RING Finger LIM Domain-binding Protein, R-LIM, E3 Ubiquitin-protein Ligase RLIM, LIM Domain-interacting RING Finger Protein, RING Finger Protein 12, RNF12, Renal Carcinoma Antigen NY-REN-43) (APC)
Recombinant Staphylococcus aureus TelA-like protein MW1294 (MW1294)
Recombinant Staphylococcus aureus TelA-like protein MW1294 (MW1294)
Recombinant Staphylococcus aureus TelA-like protein MW1294 (MW1294)