AIFM1 Antibody

AIFM1 antibody, AIFM1_HUMAN antibody, Apoptosis inducing factor 1, mitochondrial antibody, Apoptosis inducing factor antibody, Apoptosis inducing factor, mitochondrion associated, 1 antibody, Apoptosis-inducing factor 1 antibody, CMTX4 antibody, COXPD6 antibody, Harlequin antibody, Hq antibody, mAIF antibody, MGC111425 antibody, MGC5706 antibody, mitochondrial antibody, Neuropathy, axonal motor-sensory, with deafness and mental retardation antibody, neuropathy, axonal, motor-sensory with deafness and mental retardation (Cowchock syndrome) antibody, PDCD 8 antibody, PDCD8 antibody, Programmed cell death 8 (apoptosis inducing factor) antibody, Programmed cell death 8 antibody, Programmed cell death 8 isoform 1 antibody, Programmed cell death 8 isoform 2 antibody, Programmed cell death 8 isoform 3 antibody, Programmed cell death protein 8 antibody, Programmed cell death protein 8 mitochondrial antibody, Programmed cell death protein 8 mitochondrial precursor antibody, Striatal apoptosis inducing factor antibody

A synthetic peptide corresponding to a sequence at the C-terminus of human AIF (582-613aa FNRMPIARKIIKDGEQHEDLNEVAKLFNIHED), identical to the related mouse and rat sequences.