Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GJA1, Human (His)

The GJA1 protein regulates bladder capacity through gap junctions, clusters of transmembrane channels that allow the diffusion of low molecular weight materials between adjacent cells. GJA1 protein also regulates NOV expression and localization and is important for ventricular gap junction communication. GJA1 Protein, Human (His) is the recombinant human-derived GJA1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

GJA1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gja1-protein-human-his.html

Purity

90.00

Smiles

FKGVKDRVKGKSDPYHATSGALSPAKDCGSQKYAYFNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRNYNKQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDNQNSKKLAAGHELQPLAIVDQRPSSRASSRASSRPRPDDLEI

Molecular Formula

2697 (Gene_ID) P17302 (F233-I382) (Accession)

Molecular Weight

Approximately 22 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rat Carcinoembryonic Antigen Related Cell Adhesion Molecule 1 (CEACAM1) Protein
abx065725-01 10 µg

Rat Carcinoembryonic Antigen Related Cell Adhesion Molecule 1 (CEACAM1) Protein

Ask
View Details
Rat Carcinoembryonic Antigen Related Cell Adhesion Molecule 1 (CEACAM1) Protein
abx065725-02 50 µg

Rat Carcinoembryonic Antigen Related Cell Adhesion Molecule 1 (CEACAM1) Protein

Ask
View Details
Rat Carcinoembryonic Antigen Related Cell Adhesion Molecule 1 (CEACAM1) Protein
abx065725-03 100 µg

Rat Carcinoembryonic Antigen Related Cell Adhesion Molecule 1 (CEACAM1) Protein

Ask
View Details
Rat Carcinoembryonic Antigen Related Cell Adhesion Molecule 1 (CEACAM1) Protein
abx065725-04 200 µg

Rat Carcinoembryonic Antigen Related Cell Adhesion Molecule 1 (CEACAM1) Protein

Ask
View Details
Rat Carcinoembryonic Antigen Related Cell Adhesion Molecule 1 (CEACAM1) Protein
abx065725-05 500 µg

Rat Carcinoembryonic Antigen Related Cell Adhesion Molecule 1 (CEACAM1) Protein

Ask
View Details
GENLISA Human Free Testosterone (F-TESTO) ELISA
KBH10781 1x 96 Well

GENLISA Human Free Testosterone (F-TESTO) ELISA

Ask
View Details