GJA1, Human (His)
The GJA1 protein regulates bladder capacity through gap junctions, clusters of transmembrane channels that allow the diffusion of low molecular weight materials between adjacent cells. GJA1 protein also regulates NOV expression and localization and is important for ventricular gap junction communication. GJA1 Protein, Human (His) is the recombinant human-derived GJA1 protein, expressed by E. coli , with N-6*His labeled tag.
Product Specifications
Product Name Alternative
GJA1 Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/gja1-protein-human-his.html
Purity
90.00
Smiles
FKGVKDRVKGKSDPYHATSGALSPAKDCGSQKYAYFNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRNYNKQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDNQNSKKLAAGHELQPLAIVDQRPSSRASSRASSRPRPDDLEI
Molecular Formula
2697 (Gene_ID) P17302 (F233-I382) (Accession)
Molecular Weight
Approximately 22 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
CRSP9 (ARC34, Mediator of RNA Polymerase II Transcription Subunit 7, Activator-recruited Cofactor 34kD Component, Cofactor Required for Sp1 Transcriptional Activation Subunit 9, Mediator Complex Subunit 7, RNA Polymerase Transcriptional Regulation Mediator Subunit 7 Homolog, Transcriptional Coactivator CRSP33, MGC12284) (MaxLight 550)
