Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GJA1, Human (His)

The GJA1 protein regulates bladder capacity through gap junctions, clusters of transmembrane channels that allow the diffusion of low molecular weight materials between adjacent cells. GJA1 protein also regulates NOV expression and localization and is important for ventricular gap junction communication. GJA1 Protein, Human (His) is the recombinant human-derived GJA1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

GJA1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gja1-protein-human-his.html

Purity

90.00

Smiles

FKGVKDRVKGKSDPYHATSGALSPAKDCGSQKYAYFNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRNYNKQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDNQNSKKLAAGHELQPLAIVDQRPSSRASSRASSRPRPDDLEI

Molecular Formula

2697 (Gene_ID) P17302 (F233-I382) (Accession)

Molecular Weight

Approximately 22 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD8 (RIV11), CF488A conjugate, 0.1mg/mL
BNC880333-100 1x 100 µL

CD8 (RIV11), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD4 (EDU-2), CF594 conjugate, 0.1mg/mL
BNC940345-100 1x 100 µL

CD4 (EDU-2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF740 conjugate, 0.1mg/mL
BNC740391-500 1x 500 µL

CD81 / TAPA-1 (1.3.3.22), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF740 conjugate, 0.1mg/mL
BNC740679-500 1x 500 µL

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (C8/1035), CF647 conjugate, 0.1mg/mL
BNC471035-100 1x 100 µL

CD8 (C8/1035), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAGE A1 (MA454), CF647 conjugate, 0.1mg/mL
BNC470008-500 1x 500 µL

MAGE A1 (MA454), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details