CD5, Rhesus Macaque (HEK293, His-Avi)
CD5 Protein lacks conserved residue (s) essential for feature annotation propagation. CD5 Protein, Rhesus Macaque (HEK293, His-Avi) is the recombinant Rhesus Macaque-derived CD5 protein, expressed by HEK293 , with C-Avi, C-His labeled tag.
Product Specifications
Product Name Alternative
CD5 Protein, Rhesus Macaque (HEK293, His-Avi), Rhesus Macaque, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/cd5-protein-rhesus-macaque-hek293-his-avi.html
Purity
95.0
Smiles
RLSWDDPDFQTRLTRSNSRCQGQLEVYIKYGWHMVCSQSWGRSSNQWEDPNQASKVCQRLNCGVPLSLGPFLITDRHQSQITCYGRLGSFSNCSHSGRDVCRPLGLTCLEPQTTTPPPTRPPPTTTPEPTAPPRLQLVAQAAGRHCAGVVEFYSGSLGGTISYEAQDKAQDKTQVLENFLCSSLQCGSFLKHLPETEAATAQDPGELREHQPLPIQWTIRNSSCTSLEHCFQKIKPRNSGQVLALLCSGFQPKVQSRLVGSSICEGTVEVRQGAQWAALCDSSSAKSSLRWEEVCREQQCGSFNSYQALDAGDPTSRGLSCPHQKLSQCHELTERKSYCKKVFVTCQDPNP
Molecular Formula
/ (Gene_ID) F6V5Q9 (R25-P375) (Accession)
Molecular Weight
55-60 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC680158-100 1x 100 µL
Cytokeratin 17 (E3), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880270-500 1x 500 µL
Fibronectin (HFN7.1), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040017-100 1x 100 µL
Ep-CAM / CD326 (VU-1D9), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740266-100 1x 100 µL
Human IgG Immunoglobulin (IG266), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC881958-500 1x 500 µL
Cytokeratin 19 (Pancreatic Stem Cell Marker) (rKRT19/800), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details