Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD5, Rhesus Macaque (HEK293, His-Avi)

CD5 Protein lacks conserved residue (s) essential for feature annotation propagation. CD5 Protein, Rhesus Macaque (HEK293, His-Avi) is the recombinant Rhesus Macaque-derived CD5 protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

Product Specifications

Product Name Alternative

CD5 Protein, Rhesus Macaque (HEK293, His-Avi), Rhesus Macaque, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd5-protein-rhesus-macaque-hek293-his-avi.html

Purity

95.0

Smiles

RLSWDDPDFQTRLTRSNSRCQGQLEVYIKYGWHMVCSQSWGRSSNQWEDPNQASKVCQRLNCGVPLSLGPFLITDRHQSQITCYGRLGSFSNCSHSGRDVCRPLGLTCLEPQTTTPPPTRPPPTTTPEPTAPPRLQLVAQAAGRHCAGVVEFYSGSLGGTISYEAQDKAQDKTQVLENFLCSSLQCGSFLKHLPETEAATAQDPGELREHQPLPIQWTIRNSSCTSLEHCFQKIKPRNSGQVLALLCSGFQPKVQSRLVGSSICEGTVEVRQGAQWAALCDSSSAKSSLRWEEVCREQQCGSFNSYQALDAGDPTSRGLSCPHQKLSQCHELTERKSYCKKVFVTCQDPNP

Molecular Formula

/ (Gene_ID) F6V5Q9 (R25-P375) (Accession)

Molecular Weight

55-60 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse PGLYRP2/PGRP-L MAb (Clone 439728)
MAB4704-SP 25 µg

Mouse PGLYRP2/PGRP-L MAb (Clone 439728)

Sign In for Pricing
View Details
WBP2 Antibody
MBS9521839-01 0.04 mL

WBP2 Antibody

Sign In for Pricing
View Details
WBP2 Antibody
MBS9521839-02 0.1 mL

WBP2 Antibody

Sign In for Pricing
View Details
WBP2 Antibody
MBS9521839-03 0.2 mL

WBP2 Antibody

Sign In for Pricing
View Details
WBP2 Antibody
MBS9521839-04 5x 0.2 mL

WBP2 Antibody

Sign In for Pricing
View Details
SNORA70D AAV Vector (Human) (CMV)
44647101 1 µg

SNORA70D AAV Vector (Human) (CMV)

Sign In for Pricing
View Details