Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-27 beta/EBI3, Human (His)

The IL-27 beta/EBI3 protein binds to IL27 to form IL-27 interleukin, which is critical in innate immunity. IL-27 has both pro- and anti-inflammatory properties, regulating T helper cell development, inhibiting T cell proliferation, stimulating cytotoxic T cell activity, inducing B cell isotype switching, and affecting innate immune cells. Animal-Free IL-27 beta/EBI3 Protein, Human (His) is the recombinant human-derived animal-FreeIL-27 beta/EBI3 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-27 beta/EBI3 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-27-beta-ebi3-protein-human-his.html

Purity

95.00

Smiles

MRKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPVSFIATYRLGMAARGHSWPCLQQTPTSTSCTITDVQLFSMAPYVLNVTAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRVGPIEATSFILRAVRPRARYYVQVAAQDLTDYGELSDWSLPATATMSLGK

Molecular Formula

10148 (Gene_ID) Q14213 (R21-K229) (Accession)

Molecular Weight

Approximately 25 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog