Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fas/CD95, Mouse (HEK293, His)

Fas receptor is a cell surface death receptor, can bind to Fas ligand to form death-inducing signaling complexes, such as Fas associated death domain proteins (FADD) [1][2]. Fas receptor participates in the caspase cascade and regulate the activation of JNK and p38-K downstream. It is also involved in the signaling cascade of ERK/JNK MAPKs, activating MAPK3/ERK1, MAPK8/JNK and NF-κB, which has been implicated in the pathogenesis of various malignant tumors and immune system diseases[3][4]. Mouse Fas receptor contain a death domain (222-306 a.a.) that plays a key role in regulating programmed death. Fas/CD95 Protein, Mouse (HEK293, His) has a full length of 148 amino acids (Q22-R169), produced in HEK293 cells with C-terminal 6*His-tag.

Product Specifications

Product Name Alternative

Fas/CD95 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tnfrsf6-cd95-protein-mouse-hek-293-his.html

Purity

95.00

Smiles

QGTNSISESLKLRRRVRETDKNCSEGLYQGGPFCCQPCQPGKKKVEDCKMNGGTPTCAPCTEGKEYMDKNHYADKCRRCTLCDEEHGLEVETNCTLTQNTKCKCKPDFYCDSPGCEHCVRCASCEHGTLEPCTATSNTNCRKQSPRNR

Molecular Formula

14102 (Gene_ID) P25446 (Q22-R169) (Accession)

Molecular Weight

25-35 kDa

References & Citations

[1]Liu C, et al. Differential expression of human Fas mRNA species upon peripheral blood mononuclear cell activation. Biochem J. 1995 Sep 15;310 (Pt 3) (Pt 3) :957-63.|[2]Screaton RA, et al. Fas-associated death domain protein interacts with methyl-CpG binding domain protein 4: a potential link between genome surveillance and apoptosis. Proc Natl Acad Sci U S A. 2003 Apr 29;100 (9) :5211-6.|[3]Brenner B, et al. Fas/CD95/Apo-I activates the acidic sphingomyelinase via caspases. Cell Death Differ. 1998 Jan;5 (1) :29-37.|[4]Lee SM, et al. Stimulation of Fas (CD95) induces production of pro-inflammatory mediators through ERK/JNK-dependent activation of NF-κB in THP-1 cells. Cell Immunol. 2011;271 (1) :157-62.|[5]Peng SL, et al. A tumor-suppressor function for Fas (CD95) revealed in T cell-deficient mice. J Exp Med. 1996 Sep 1;184 (3) :1149-54.|[6]Mogil RJ, et al. Fas (CD95) participates in peripheral T cell deletion and associated apoptosis in vivo. Int Immunol. 1995 Sep;7 (9) :1451-8.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

KMO (Kynurenine 3-Monooxygenase, Kynurenine 3-Monooxygenase (Kynurenine 3-Hydroxylase) )
484434 100 µL

KMO (Kynurenine 3-Monooxygenase, Kynurenine 3-Monooxygenase (Kynurenine 3-Hydroxylase) )

Sign In for Pricing
View Details
SNAP29 Recombinant Antibody, AbBy Fluor™ 405 Conjugated
bsm-62550R-BF405 100 µL

SNAP29 Recombinant Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
CXorf58 sgRNA CRISPR Lentivector (Human) (Target 3)
K0540004 1.0 µg DNA

CXorf58 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Recombinant Myxococcus xanthus Imidazolonepropionase (hutI)
MBS1379663-01 0.02 mg (E-Coli)

Recombinant Myxococcus xanthus Imidazolonepropionase (hutI)

Sign In for Pricing
View Details
Recombinant Myxococcus xanthus Imidazolonepropionase (hutI)
MBS1379663-02 0.02 mg (Yeast)

Recombinant Myxococcus xanthus Imidazolonepropionase (hutI)

Sign In for Pricing
View Details
Recombinant Myxococcus xanthus Imidazolonepropionase (hutI)
MBS1379663-03 0.1 mg (E-Coli)

Recombinant Myxococcus xanthus Imidazolonepropionase (hutI)

Sign In for Pricing
View Details