Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fas/CD95, Mouse (HEK293, His)

Fas receptor is a cell surface death receptor, can bind to Fas ligand to form death-inducing signaling complexes, such as Fas associated death domain proteins (FADD) [1][2]. Fas receptor participates in the caspase cascade and regulate the activation of JNK and p38-K downstream. It is also involved in the signaling cascade of ERK/JNK MAPKs, activating MAPK3/ERK1, MAPK8/JNK and NF-κB, which has been implicated in the pathogenesis of various malignant tumors and immune system diseases[3][4]. Mouse Fas receptor contain a death domain (222-306 a.a.) that plays a key role in regulating programmed death. Fas/CD95 Protein, Mouse (HEK293, His) has a full length of 148 amino acids (Q22-R169), produced in HEK293 cells with C-terminal 6*His-tag.

Product Specifications

Product Name Alternative

Fas/CD95 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tnfrsf6-cd95-protein-mouse-hek-293-his.html

Purity

95.00

Smiles

QGTNSISESLKLRRRVRETDKNCSEGLYQGGPFCCQPCQPGKKKVEDCKMNGGTPTCAPCTEGKEYMDKNHYADKCRRCTLCDEEHGLEVETNCTLTQNTKCKCKPDFYCDSPGCEHCVRCASCEHGTLEPCTATSNTNCRKQSPRNR

Molecular Formula

14102 (Gene_ID) P25446 (Q22-R169) (Accession)

Molecular Weight

25-35 kDa

References & Citations

[1]Liu C, et al. Differential expression of human Fas mRNA species upon peripheral blood mononuclear cell activation. Biochem J. 1995 Sep 15;310 (Pt 3) (Pt 3) :957-63.|[2]Screaton RA, et al. Fas-associated death domain protein interacts with methyl-CpG binding domain protein 4: a potential link between genome surveillance and apoptosis. Proc Natl Acad Sci U S A. 2003 Apr 29;100 (9) :5211-6.|[3]Brenner B, et al. Fas/CD95/Apo-I activates the acidic sphingomyelinase via caspases. Cell Death Differ. 1998 Jan;5 (1) :29-37.|[4]Lee SM, et al. Stimulation of Fas (CD95) induces production of pro-inflammatory mediators through ERK/JNK-dependent activation of NF-κB in THP-1 cells. Cell Immunol. 2011;271 (1) :157-62.|[5]Peng SL, et al. A tumor-suppressor function for Fas (CD95) revealed in T cell-deficient mice. J Exp Med. 1996 Sep 1;184 (3) :1149-54.|[6]Mogil RJ, et al. Fas (CD95) participates in peripheral T cell deletion and associated apoptosis in vivo. Int Immunol. 1995 Sep;7 (9) :1451-8.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr282 Protein Vector (Mouse) (pPB-N-His)
PV209999 500 ng

Olfr282 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Monoclonal Calumenin Antibody
APR15260G 0.1ml

Monoclonal Calumenin Antibody

Sign In for Pricing
View Details
Inhibitor hsa-miR-525-5p AAV miRNA Vector
Amh3095800 500 ng

Inhibitor hsa-miR-525-5p AAV miRNA Vector

Sign In for Pricing
View Details
Mouse Spopl Pre-designed siRNA Set B
SI113755B 1 Each

Mouse Spopl Pre-designed siRNA Set B

Sign In for Pricing
View Details
Protein Kinase C Delta Type, Recombinant, Human, aa1-676, His-Tag
585980-01 20 µg

Protein Kinase C Delta Type, Recombinant, Human, aa1-676, His-Tag

Sign In for Pricing
View Details
Protein Kinase C Delta Type, Recombinant, Human, aa1-676, His-Tag
585980-02 100 µg

Protein Kinase C Delta Type, Recombinant, Human, aa1-676, His-Tag

Sign In for Pricing
View Details