SARS-CoV-2 PLpro
The multifunctional SARS-CoV-2 PP1ab protein is essential for viral RNA transcription and replication, utilizing proteases for multi-protein cleavage. It inhibits host translation by binding to the 40S subunit and blocks ribosomal mRNA entry channels, thereby hindering the antiviral response. SARS-CoV-2 PLpro Protein is the recombinant Virus-derived SARS-CoV-2 PLpro protein, expressed by E. coli , with tag free.
Product Specifications
Product Name Alternative
SARS-CoV-2 PLpro Protein, Virus, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/sars-cov-2-plpro-protein.html
Purity
98.0
Smiles
EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVFYKENSYTTTIK
Molecular Formula
43740578 (Gene_ID) P0DTD1-1/YP_009724389.1 (E1564-K1878) (Accession)
Molecular Weight
Approximately 34.0 kDa
Shipping Conditions
Dry ice.
Storage Conditions
Stored at -80°C for 1 year
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
411549 11mL
1’-Hydroxy Midazolam (1.0 mg/mL in methanol) discontinued
Sign In for Pricing
View Details 
MBS7041396-01 0.02 mg
Recombinant Vitreoscilla sp. Probable intracellular septation protein A
Sign In for Pricing
View Details MBS7041396-02 0.1 mg
Recombinant Vitreoscilla sp. Probable intracellular septation protein A
Sign In for Pricing
View Details MBS7041396-03 5x 0.1 mg
Recombinant Vitreoscilla sp. Probable intracellular septation protein A
Sign In for Pricing
View Details