Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Alpha-1-acid glycoprotein (Orm1)

Product Specifications

Product Name Alternative

Orosomucoid (OMD)

Abbreviation

Recombinant Rat Orm1 protein

Gene Name

Orm1

UniProt

P02764

Expression Region

19-205aa

Organism

Rattus norvegicus (Rat)

Target Sequence

QNPEPANITLGIPITNETLKWLSDKWFYMGAAFRDPVFKQAVQTIQTEYFYLTPNLINDTIELREFQTTDDQCVYNFTHLGVQRENGTLSKCAGAVKIFAHLIVLKKHGTFMLAFNLTDENRGLSFYAKKPDLSPELRKIFQQAVKDVGMDESEIVFVDWTKDKCSEQQKQQLELEKETKKETKKDP

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cardiovascular

Relevance

Functions as transport protein in the blood stream. Binds various ligands in the interior of its beta-barrel domain (By similarity) . Appears to function in modulating the activity of the immune system during the acute-phase reaction.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

25.7 kDa

References & Citations

"Nucleotide sequence of rat alpha 1-acid glycoprotein messenger RNA." Ricca G.A., Taylor J.M. J. Biol. Chem. 256:11199-11202 (1981)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCBD2 (1P11) Rabbit Monoclonal Antibody
E28M3314 100 µL

PCBD2 (1P11) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
CACNA1G (NM_001256325) Human Untagged Clone
SC332348 10 µg

CACNA1G (NM_001256325) Human Untagged Clone

Sign In for Pricing
View Details
OPMA04163-10UG - Human Laminin 5 Protein
OPMA04163-10UG 0.01 mg

OPMA04163-10UG - Human Laminin 5 Protein

Sign In for Pricing
View Details
GJE1 Protein Vector (Rat) (pPM-C-HA)
21556026 500 ng

GJE1 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Mouse Trappin 2 ELISA kit
GTR10460308 96 Well

Mouse Trappin 2 ELISA kit

Sign In for Pricing
View Details
Ehbp1l1 (NM_001114597) Mouse Tagged ORF Clone
MG218140 10 µg

Ehbp1l1 (NM_001114597) Mouse Tagged ORF Clone

Sign In for Pricing
View Details