Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AKR1C3, Human (HEK293, His)

AKR1C3 Protein, Human (HEK293, His) expresses in HEK293 cells with a His tag. Aldo-keto reductase family 1 member C3 (AKR1C3) is a steroidogenic enzyme that plays a crucial role in the conversion of adrenal androgen dehydroepiandrosterone (DHEA) into high-affinity ligands for the androgen receptor (testosterone [T] and dihydrotestosterone [DHT]) [1].

Product Specifications

Product Name Alternative

AKR1C3 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ark1c3-protein-human-hek293-his.html

Purity

95.0

Smiles

MDSKHQCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYSDEYHHHHHH

Molecular Formula

8644 (Gene_ID) P42330 (M1-S323) (Accession)

Molecular Weight

Approximately 38.0 kDa

References & Citations

[1]Agus Rizal A H Hamid, et al. Aldo-keto reductase family 1 member C3 (AKR1C3) is a biomarker and therapeutic target for castration-resistant prostate cancer. Mol Med. 2013 Jan 22;18 (1) :1449-55.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Chrnb4 ELISA Kit
ELI-35090r 96 Tests

Rat Chrnb4 ELISA Kit

Sign In for Pricing
View Details
Anti-Nestin Antibody
bs-70946R 100 µL

Anti-Nestin Antibody

Sign In for Pricing
View Details
Mouse Monoclonal Cyclin B2 Antibody (X121.10) [Alexa Fluor 647]
NB100-2612AF647 0.1 mL

Mouse Monoclonal Cyclin B2 Antibody (X121.10) [Alexa Fluor 647]

Sign In for Pricing
View Details
AGTRAP Human qPCR Template Standard (NM_020350)
HK210800 1 Kit

AGTRAP Human qPCR Template Standard (NM_020350)

Sign In for Pricing
View Details
Cyclin B1 Antibody
V7161-20UG 20 µg

Cyclin B1 Antibody

Sign In for Pricing
View Details
Human Hexokinase 2 Recombinant Protein
PROTP52789-500ug 500 µg

Human Hexokinase 2 Recombinant Protein

Sign In for Pricing
View Details