AKR1C3, Human (HEK293, His)
AKR1C3 Protein, Human (HEK293, His) expresses in HEK293 cells with a His tag. Aldo-keto reductase family 1 member C3 (AKR1C3) is a steroidogenic enzyme that plays a crucial role in the conversion of adrenal androgen dehydroepiandrosterone (DHEA) into high-affinity ligands for the androgen receptor (testosterone [T] and dihydrotestosterone [DHT]) [1].
Product Specifications
Product Name Alternative
AKR1C3 Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/ark1c3-protein-human-hek293-his.html
Purity
95.0
Smiles
MDSKHQCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYSDEYHHHHHH
Molecular Formula
8644 (Gene_ID) P42330 (M1-S323) (Accession)
Molecular Weight
Approximately 38.0 kDa
References & Citations
[1]Agus Rizal A H Hamid, et al. Aldo-keto reductase family 1 member C3 (AKR1C3) is a biomarker and therapeutic target for castration-resistant prostate cancer. Mol Med. 2013 Jan 22;18 (1) :1449-55.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
TA371498 100 µL
Adenosine A2b Receptor (ADORA2B) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details 
134700-FITC 100 µL
Trefoil Factor 2 (TFF2, SML1, Spasmolysin, Spasmolytic Polypeptide, SP) (FITC)
Sign In for Pricing
View Details MBS6477079-01 0.1 mL
FOXO3A (Forkhead box O3, AF6q21, AF6q21 protein, DKFZp781A0677, FKHRL1, FKHRL1P2, Forkhead box protein O3, Forkhead in rhabdomyosarcoma-like 1, FOXO2, MGC12739, MGC31925) (MaxLight 490)
Sign In for Pricing
View Details