Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AKR1C3, Human (HEK293, His)

AKR1C3 Protein, Human (HEK293, His) expresses in HEK293 cells with a His tag. Aldo-keto reductase family 1 member C3 (AKR1C3) is a steroidogenic enzyme that plays a crucial role in the conversion of adrenal androgen dehydroepiandrosterone (DHEA) into high-affinity ligands for the androgen receptor (testosterone [T] and dihydrotestosterone [DHT]) [1].

Product Specifications

Product Name Alternative

AKR1C3 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ark1c3-protein-human-hek293-his.html

Purity

95.0

Smiles

MDSKHQCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYSDEYHHHHHH

Molecular Formula

8644 (Gene_ID) P42330 (M1-S323) (Accession)

Molecular Weight

Approximately 38.0 kDa

References & Citations

[1]Agus Rizal A H Hamid, et al. Aldo-keto reductase family 1 member C3 (AKR1C3) is a biomarker and therapeutic target for castration-resistant prostate cancer. Mol Med. 2013 Jan 22;18 (1) :1449-55.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cyclophilin A (PPIA) (NM_021130) Human Tagged Lenti ORF Clone
RC203307L4 10 µg

Cyclophilin A (PPIA) (NM_021130) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
RPL7AP30 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV775293 1.0 µg DNA

RPL7AP30 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
GRID1 (Glutamate Receptor, Ionotropic, delta 1, KIAA1220) (MaxLight 750) discontinued
246762-ML750 100 µL

GRID1 (Glutamate Receptor, Ionotropic, delta 1, KIAA1220) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Chlorhexidine dihydrochloride
MF-0018262-01 1 mL - 10 mM (in DMSO)

Chlorhexidine dihydrochloride

Sign In for Pricing
View Details
Chlorhexidine dihydrochloride
MF-0018262-02 10 g

Chlorhexidine dihydrochloride

Sign In for Pricing
View Details
CD Markers CDw78 (MHC II DR)
60-3G2 100 μg

CD Markers CDw78 (MHC II DR)

Sign In for Pricing
View Details