Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AKR1C3, Human (HEK293, His)

AKR1C3 Protein, Human (HEK293, His) expresses in HEK293 cells with a His tag. Aldo-keto reductase family 1 member C3 (AKR1C3) is a steroidogenic enzyme that plays a crucial role in the conversion of adrenal androgen dehydroepiandrosterone (DHEA) into high-affinity ligands for the androgen receptor (testosterone [T] and dihydrotestosterone [DHT]) [1].

Product Specifications

Product Name Alternative

AKR1C3 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ark1c3-protein-human-hek293-his.html

Purity

95.0

Smiles

MDSKHQCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYSDEYHHHHHH

Molecular Formula

8644 (Gene_ID) P42330 (M1-S323) (Accession)

Molecular Weight

Approximately 38.0 kDa

References & Citations

[1]Agus Rizal A H Hamid, et al. Aldo-keto reductase family 1 member C3 (AKR1C3) is a biomarker and therapeutic target for castration-resistant prostate cancer. Mol Med. 2013 Jan 22;18 (1) :1449-55.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-CD96 Antibody (4I321)
MF-0070565 100 µL

Anti-CD96 Antibody (4I321)

Sign In for Pricing
View Details
NKX2-5 (NK2 Transcription Factor Related, locus 5 (Drosophila), CHNG5, CSX, CSX1, NKX2.5, NKX2E, NKX4-1) (APC)
249334-APC 100 µL

NKX2-5 (NK2 Transcription Factor Related, locus 5 (Drosophila), CHNG5, CSX, CSX1, NKX2.5, NKX2E, NKX4-1) (APC)

Sign In for Pricing
View Details
Recombinant Human TBC1D22B, GST-tagged
TBC1D22B-3128H 25 µg

Recombinant Human TBC1D22B, GST-tagged

Sign In for Pricing
View Details
TSLC1 siRNA (m)
sc-37519 10 µM

TSLC1 siRNA (m)

Sign In for Pricing
View Details
ARID1A Antibody / AT rich interactive domain 1A
V5814-100UG 100 µg

ARID1A Antibody / AT rich interactive domain 1A

Sign In for Pricing
View Details
Munc 13 4 (UNC13D) Rabbit Polyclonal Antibody
TA337705 100 µL

Munc 13 4 (UNC13D) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details