Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AKR1C3, Human (HEK293, His)

AKR1C3 Protein, Human (HEK293, His) expresses in HEK293 cells with a His tag. Aldo-keto reductase family 1 member C3 (AKR1C3) is a steroidogenic enzyme that plays a crucial role in the conversion of adrenal androgen dehydroepiandrosterone (DHEA) into high-affinity ligands for the androgen receptor (testosterone [T] and dihydrotestosterone [DHT]) [1].

Product Specifications

Product Name Alternative

AKR1C3 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ark1c3-protein-human-hek293-his.html

Purity

95.0

Smiles

MDSKHQCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYSDEYHHHHHH

Molecular Formula

8644 (Gene_ID) P42330 (M1-S323) (Accession)

Molecular Weight

Approximately 38.0 kDa

References & Citations

[1]Agus Rizal A H Hamid, et al. Aldo-keto reductase family 1 member C3 (AKR1C3) is a biomarker and therapeutic target for castration-resistant prostate cancer. Mol Med. 2013 Jan 22;18 (1) :1449-55.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Anti-GCSH Antibody, Rabbit Monoclonal
MBS8107415-01 0.1 mL

Recombinant Anti-GCSH Antibody, Rabbit Monoclonal

Sign In for Pricing
View Details
Recombinant Anti-GCSH Antibody, Rabbit Monoclonal
MBS8107415-02 5x 0.1 mL

Recombinant Anti-GCSH Antibody, Rabbit Monoclonal

Sign In for Pricing
View Details
NCAPD2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K1397208 1.0 µg DNA

NCAPD2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
SULT2B1 Rabbit Polyclonal Antibody
TA382199 100 µL

SULT2B1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PIAS4 3'UTR GFP Stable Cell Line
TU067920 1.0 mL

PIAS4 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
NCLN Protein Vector (Mouse) (pPM-C-His)
PV204401 500 ng

NCLN Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details