Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AKR1C3, Human (HEK293, His)

AKR1C3 Protein, Human (HEK293, His) expresses in HEK293 cells with a His tag. Aldo-keto reductase family 1 member C3 (AKR1C3) is a steroidogenic enzyme that plays a crucial role in the conversion of adrenal androgen dehydroepiandrosterone (DHEA) into high-affinity ligands for the androgen receptor (testosterone [T] and dihydrotestosterone [DHT]) [1].

Product Specifications

Product Name Alternative

AKR1C3 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ark1c3-protein-human-hek293-his.html

Purity

95.0

Smiles

MDSKHQCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYSDEYHHHHHH

Molecular Formula

8644 (Gene_ID) P42330 (M1-S323) (Accession)

Molecular Weight

Approximately 38.0 kDa

References & Citations

[1]Agus Rizal A H Hamid, et al. Aldo-keto reductase family 1 member C3 (AKR1C3) is a biomarker and therapeutic target for castration-resistant prostate cancer. Mol Med. 2013 Jan 22;18 (1) :1449-55.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM11 (NM_003876) Human Recombinant Protein
PH40727M5 20 µg

TMEM11 (NM_003876) Human Recombinant Protein

Sign In for Pricing
View Details
Prss34 (NM_001105772) Rat Tagged ORF Clone Lentiviral Particle
RR206732L3V 200 µL

Prss34 (NM_001105772) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
SAMD5 Protein Lysate (Rat) with C-HA Tag
43000036 100 µg

SAMD5 Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
LCK Rabbit Polyclonal Antibody
TA354687 100 µg

LCK Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Lrrc4 sgRNA CRISPR Lentivector set (Mouse)
K3582701 3x 1.0 µg

Lrrc4 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
Tcp11l1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
46417114 3x 1.0 µg

Tcp11l1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details