Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AKR1C3, Human (HEK293, His)

AKR1C3 Protein, Human (HEK293, His) expresses in HEK293 cells with a His tag. Aldo-keto reductase family 1 member C3 (AKR1C3) is a steroidogenic enzyme that plays a crucial role in the conversion of adrenal androgen dehydroepiandrosterone (DHEA) into high-affinity ligands for the androgen receptor (testosterone [T] and dihydrotestosterone [DHT]) [1].

Product Specifications

Product Name Alternative

AKR1C3 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ark1c3-protein-human-hek293-his.html

Purity

95.0

Smiles

MDSKHQCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYSDEYHHHHHH

Molecular Formula

8644 (Gene_ID) P42330 (M1-S323) (Accession)

Molecular Weight

Approximately 38.0 kDa

References & Citations

[1]Agus Rizal A H Hamid, et al. Aldo-keto reductase family 1 member C3 (AKR1C3) is a biomarker and therapeutic target for castration-resistant prostate cancer. Mol Med. 2013 Jan 22;18 (1) :1449-55.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NARS (Asparaginyl-tRNA Synthetase, ASNRS, NARS1) (PE)
249142-PE 100 µL

NARS (Asparaginyl-tRNA Synthetase, ASNRS, NARS1) (PE)

Sign In for Pricing
View Details
NRSN1 Protein Vector (Rat) (pPB-C-His)
PV286098 500 ng

NRSN1 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
Gemin6 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K4520404 1.0 µg DNA

Gemin6 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Potassium sodium tartrate tetrahydrate
GK0360-5kg 5 Kg

Potassium sodium tartrate tetrahydrate

Sign In for Pricing
View Details
Recombinant Human ENOX2
MBS7614868-01 0.05 mg

Recombinant Human ENOX2

Sign In for Pricing
View Details
Recombinant Human ENOX2
MBS7614868-02 0.2 mg

Recombinant Human ENOX2

Sign In for Pricing
View Details