AKR1C3, Human (HEK293, His)
AKR1C3 Protein, Human (HEK293, His) expresses in HEK293 cells with a His tag. Aldo-keto reductase family 1 member C3 (AKR1C3) is a steroidogenic enzyme that plays a crucial role in the conversion of adrenal androgen dehydroepiandrosterone (DHEA) into high-affinity ligands for the androgen receptor (testosterone [T] and dihydrotestosterone [DHT]) [1].
Product Specifications
Product Name Alternative
AKR1C3 Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/ark1c3-protein-human-hek293-his.html
Purity
95.0
Smiles
MDSKHQCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYSDEYHHHHHH
Molecular Formula
8644 (Gene_ID) P42330 (M1-S323) (Accession)
Molecular Weight
Approximately 38.0 kDa
References & Citations
[1]Agus Rizal A H Hamid, et al. Aldo-keto reductase family 1 member C3 (AKR1C3) is a biomarker and therapeutic target for castration-resistant prostate cancer. Mol Med. 2013 Jan 22;18 (1) :1449-55.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
K6443406 1.0 µg DNA
Usp36 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
Sign In for Pricing
View Details 
KBH5000 96 Well
GENLISA™ Human C-C Chemokine Receptor Type 9 (CCR9) ELISA
Sign In for Pricing
View Details TR308225 1 Kit
ZFP200 (ZNF200) Human shRNA Plasmid Kit (Locus ID 7752)
Sign In for Pricing
View Details M2352-20C-01 20 µL
MAP Kinase p44/42, phosphorylated (Thr202/Tyr204) (MAPK3/MAPK1, Mitogen-activated Protein Kinase 1, MAP Kinase 1, MAPK 1, ERT1, Extracellular Signal-regulated Kinase 2, ERK-2, MAP Kinase Isoform p42, p42-MAPK, Mitogen-activated Protein Kinase 2, MAP Kinase 2, MAPK 2, ERK2, PRKM1, PRKM2 / Mitogen-activated Protein Kinase 3, MAP Kinase 3, MAPK 3, ERT2, Extracellular Signal-regulated Kinase 1, ERK-1, Insulin-stimulated MAP2 Kinase, MAP Kinase Isoform p44, p44-MAPK, Microtubule-associated Protein 2 Kinase, p44-ERK1, ERK1, PRKM3)
Sign In for Pricing
View Details M2352-20C-02 200 µL
MAP Kinase p44/42, phosphorylated (Thr202/Tyr204) (MAPK3/MAPK1, Mitogen-activated Protein Kinase 1, MAP Kinase 1, MAPK 1, ERT1, Extracellular Signal-regulated Kinase 2, ERK-2, MAP Kinase Isoform p42, p42-MAPK, Mitogen-activated Protein Kinase 2, MAP Kinase 2, MAPK 2, ERK2, PRKM1, PRKM2 / Mitogen-activated Protein Kinase 3, MAP Kinase 3, MAPK 3, ERT2, Extracellular Signal-regulated Kinase 1, ERK-1, Insulin-stimulated MAP2 Kinase, MAP Kinase Isoform p44, p44-MAPK, Microtubule-associated Protein 2 Kinase, p44-ERK1, ERK1, PRKM3)
Sign In for Pricing
View Details