Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AKR1C3, Human (HEK293, His)

AKR1C3 Protein, Human (HEK293, His) expresses in HEK293 cells with a His tag. Aldo-keto reductase family 1 member C3 (AKR1C3) is a steroidogenic enzyme that plays a crucial role in the conversion of adrenal androgen dehydroepiandrosterone (DHEA) into high-affinity ligands for the androgen receptor (testosterone [T] and dihydrotestosterone [DHT]) [1].

Product Specifications

Product Name Alternative

AKR1C3 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ark1c3-protein-human-hek293-his.html

Purity

95.0

Smiles

MDSKHQCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYSDEYHHHHHH

Molecular Formula

8644 (Gene_ID) P42330 (M1-S323) (Accession)

Molecular Weight

Approximately 38.0 kDa

References & Citations

[1]Agus Rizal A H Hamid, et al. Aldo-keto reductase family 1 member C3 (AKR1C3) is a biomarker and therapeutic target for castration-resistant prostate cancer. Mol Med. 2013 Jan 22;18 (1) :1449-55.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal CEACAM5/CD66e Antibody (SPM506) [mFluor Violet 610 SE]
NBP2-47975MFV610 0.1 mL

Mouse Monoclonal CEACAM5/CD66e Antibody (SPM506) [mFluor Violet 610 SE]

Sign In for Pricing
View Details
SENP3 CRISPR Knock Out 293T Cell Line (Human)
43373141 1x 10^6 Cells / 1.0 mL

SENP3 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
TBX5 Rabbit Polyclonal Antibody
TA334175 100 µL

TBX5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Trifunctional fatty acid
MF-0129231-01 10 mg

Trifunctional fatty acid

Sign In for Pricing
View Details
Trifunctional fatty acid
MF-0129231-02 50 mg

Trifunctional fatty acid

Sign In for Pricing
View Details
Mouse Monoclonal CD47 Antibody (IAP/964 + B6H12.2) [HRP]
NBP2-47812H 0.1 mL

Mouse Monoclonal CD47 Antibody (IAP/964 + B6H12.2) [HRP]

Sign In for Pricing
View Details