Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AKR1C3, Human (HEK293, His)

AKR1C3 Protein, Human (HEK293, His) expresses in HEK293 cells with a His tag. Aldo-keto reductase family 1 member C3 (AKR1C3) is a steroidogenic enzyme that plays a crucial role in the conversion of adrenal androgen dehydroepiandrosterone (DHEA) into high-affinity ligands for the androgen receptor (testosterone [T] and dihydrotestosterone [DHT]) [1].

Product Specifications

Product Name Alternative

AKR1C3 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ark1c3-protein-human-hek293-his.html

Purity

95.0

Smiles

MDSKHQCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYSDEYHHHHHH

Molecular Formula

8644 (Gene_ID) P42330 (M1-S323) (Accession)

Molecular Weight

Approximately 38.0 kDa

References & Citations

[1]Agus Rizal A H Hamid, et al. Aldo-keto reductase family 1 member C3 (AKR1C3) is a biomarker and therapeutic target for castration-resistant prostate cancer. Mol Med. 2013 Jan 22;18 (1) :1449-55.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ICAM3 Human
32-13264-5 5 µg

ICAM3 Human

Sign In for Pricing
View Details
Polr1h Rat siRNA Oligo Duplex (Locus ID 361784)
SR511925 1 Kit

Polr1h Rat siRNA Oligo Duplex (Locus ID 361784)

Sign In for Pricing
View Details
Recombinant Human PCNA Protein, His, E.coli-1mg
QP6470-ec-1mg 1mg

Recombinant Human PCNA Protein, His, E.coli-1mg

Sign In for Pricing
View Details
UBTF sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
49054111 3x 1.0 µg

UBTF sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
CP 524515
MF-0112885-01 10 mg

CP 524515

Sign In for Pricing
View Details
CP 524515
MF-0112885-02 50 mg

CP 524515

Sign In for Pricing
View Details