Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AKR1C3, Human (HEK293, His)

AKR1C3 Protein, Human (HEK293, His) expresses in HEK293 cells with a His tag. Aldo-keto reductase family 1 member C3 (AKR1C3) is a steroidogenic enzyme that plays a crucial role in the conversion of adrenal androgen dehydroepiandrosterone (DHEA) into high-affinity ligands for the androgen receptor (testosterone [T] and dihydrotestosterone [DHT]) [1].

Product Specifications

Product Name Alternative

AKR1C3 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ark1c3-protein-human-hek293-his.html

Purity

95.0

Smiles

MDSKHQCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYSDEYHHHHHH

Molecular Formula

8644 (Gene_ID) P42330 (M1-S323) (Accession)

Molecular Weight

Approximately 38.0 kDa

References & Citations

[1]Agus Rizal A H Hamid, et al. Aldo-keto reductase family 1 member C3 (AKR1C3) is a biomarker and therapeutic target for castration-resistant prostate cancer. Mol Med. 2013 Jan 22;18 (1) :1449-55.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fmoc-Val-Rink-Amide MBHA Resin
MBS406773-01 1 g

Fmoc-Val-Rink-Amide MBHA Resin

Sign In for Pricing
View Details
Fmoc-Val-Rink-Amide MBHA Resin
MBS406773-02 5 g

Fmoc-Val-Rink-Amide MBHA Resin

Sign In for Pricing
View Details
Fmoc-Val-Rink-Amide MBHA Resin
MBS406773-03 5x 5 g

Fmoc-Val-Rink-Amide MBHA Resin

Sign In for Pricing
View Details
C1GALT1 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated
bs-9685R-BF405 100 µL

C1GALT1 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
Stam2 siRNA Oligos set (Mouse)
45674174 3x 5 nmol

Stam2 siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
TCL1A ReadyGo IHC Kit
SIHCZ-0297-01 50 Tests (No Control Slide)

TCL1A ReadyGo IHC Kit

Sign In for Pricing
View Details