Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AKR1C3, Human (HEK293, His)

AKR1C3 Protein, Human (HEK293, His) expresses in HEK293 cells with a His tag. Aldo-keto reductase family 1 member C3 (AKR1C3) is a steroidogenic enzyme that plays a crucial role in the conversion of adrenal androgen dehydroepiandrosterone (DHEA) into high-affinity ligands for the androgen receptor (testosterone [T] and dihydrotestosterone [DHT]) [1].

Product Specifications

Product Name Alternative

AKR1C3 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ark1c3-protein-human-hek293-his.html

Purity

95.0

Smiles

MDSKHQCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYSDEYHHHHHH

Molecular Formula

8644 (Gene_ID) P42330 (M1-S323) (Accession)

Molecular Weight

Approximately 38.0 kDa

References & Citations

[1]Agus Rizal A H Hamid, et al. Aldo-keto reductase family 1 member C3 (AKR1C3) is a biomarker and therapeutic target for castration-resistant prostate cancer. Mol Med. 2013 Jan 22;18 (1) :1449-55.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Mycbpap shRNA (UAS) - Lentiviral mouse Mycbpap shRNA (UAS) (100)
GTR15175878 1 Vial

Lentiviral mouse Mycbpap shRNA (UAS) - Lentiviral mouse Mycbpap shRNA (UAS) (100)

Sign In for Pricing
View Details
Nucleoporin, 62kD (NUP62, Nuclear Pore Glycoprotein p62) discontinued
N7100-51 50 µg

Nucleoporin, 62kD (NUP62, Nuclear Pore Glycoprotein p62) discontinued

Sign In for Pricing
View Details
Human Monoclonal LAG-3 Antibody (encelimab) [Janelia Fluor 669]
NBP3-28541JF669 0.1 mL

Human Monoclonal LAG-3 Antibody (encelimab) [Janelia Fluor 669]

Sign In for Pricing
View Details
Recombinant Streptococcus Pneumoniae SPCG_1850 Protein (aa 1-244)
VAng-Ly1931-50gEcoli 50 µg (E. coli)

Recombinant Streptococcus Pneumoniae SPCG_1850 Protein (aa 1-244)

Sign In for Pricing
View Details
ZNF175 Protein Vector (Human) (pPM-C-HA)
51327021 500 ng

ZNF175 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
RAB3B Peptide - N-terminal region
MBS3245193-01 0.1 mg

RAB3B Peptide - N-terminal region

Sign In for Pricing
View Details