Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AKR1C3, Human (HEK293, His)

AKR1C3 Protein, Human (HEK293, His) expresses in HEK293 cells with a His tag. Aldo-keto reductase family 1 member C3 (AKR1C3) is a steroidogenic enzyme that plays a crucial role in the conversion of adrenal androgen dehydroepiandrosterone (DHEA) into high-affinity ligands for the androgen receptor (testosterone [T] and dihydrotestosterone [DHT]) [1].

Product Specifications

Product Name Alternative

AKR1C3 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ark1c3-protein-human-hek293-his.html

Purity

95.0

Smiles

MDSKHQCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYSDEYHHHHHH

Molecular Formula

8644 (Gene_ID) P42330 (M1-S323) (Accession)

Molecular Weight

Approximately 38.0 kDa

References & Citations

[1]Agus Rizal A H Hamid, et al. Aldo-keto reductase family 1 member C3 (AKR1C3) is a biomarker and therapeutic target for castration-resistant prostate cancer. Mol Med. 2013 Jan 22;18 (1) :1449-55.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Car3 Protein Vector (Mouse) (pPM-C-HA)
PV161528 500 ng

Car3 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
FLJ13224 Protein Vector (Human) (pPM-C-His)
PV052188 500 ng

FLJ13224 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
CYTH4 Peptide - middle region
MBS3245434-01 0.1 mg

CYTH4 Peptide - middle region

Sign In for Pricing
View Details
CYTH4 Peptide - middle region
MBS3245434-02 5x 0.1 mg

CYTH4 Peptide - middle region

Sign In for Pricing
View Details
CELF3 (NM_001172649) Human Over-expression Lysate
LC433039 20 µg

CELF3 (NM_001172649) Human Over-expression Lysate

Sign In for Pricing
View Details
StAR (D-2) : m-IgG1 BP-HRP Bundle
sc-543295 1 Kit

StAR (D-2) : m-IgG1 BP-HRP Bundle

Sign In for Pricing
View Details