MIP-1 alpha/CCL3, Mouse (His)
MIP-1 alpha/CCL3 Protein, Mouse (His), an important chemokine, is a key regulator of immune microenvironment and primarily mediates the trafficking of immune cells in both inflammation and cancer. MIP-1 alpha/CCL3 Protein, Mouse (His) is a recombinant mouse CCL3 (A24-A92) expressed by E.coil with a N-6*His tag[1].
Product Specifications
Product Name Alternative
MIP-1 alpha/CCL3 Protein, Mouse (His), Mouse, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/mip-1-alpha-ccl3-protein-mouse-his.html
Purity
97.00
Smiles
HHHHHHAPYGADTPTACCFSYSRKIPRQFIVDYFETSSLCSQPGVIFLTKRNRQICADSKETWVQEYITDLELNA
Molecular Formula
20302 (Gene_ID) P10855/Q5SVU3 (A24-A92) (Accession)
Molecular Weight
Approximately 12-15 kDa, based on SDS-PAGE under reducing conditions.
References & Citations
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
Biotin-Linked Polyclonal Antibody to Macrophage Stimulating 1 Receptor (MST1R)
Biotin-Linked Polyclonal Antibody to Macrophage Stimulating 1 Receptor (MST1R)
Biotin-Linked Polyclonal Antibody to Macrophage Stimulating 1 Receptor (MST1R)
Biotin-Linked Polyclonal Antibody to Macrophage Stimulating 1 Receptor (MST1R)
Biotin-Linked Polyclonal Antibody to Macrophage Stimulating 1 Receptor (MST1R)