Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WBP1, Human (His)

WBP1 protein interacts with NEDD4, indicating a regulatory connection.It also engages with the WW domains of YAP1, WWP1, and WWP2, implicating its role in related signaling pathways.Additionally, WBP1 interacts with WWOX, showcasing its multifaceted involvement in cellular functions and regulatory networks.Further exploration is needed to understand the specific mechanisms and functional implications of these associations.WBP1 Protein, Human (His) is the recombinant human-derived WBP1 protein, expressed by E.coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

WBP1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/wbp1-protein-human-his.html

Smiles

GTNVEGVSSHQSAPPHQEGEPGAGVTPASTPPSCRYRRLTGDSGIELCPCPASGEGEPVKEVRVSATLPDLEDYSPCALPPESVPQIFPMGLSSSEGDIP

Molecular Formula

23559 (Gene_ID) Q96G27 (G170-P269) (Accession)

Molecular Weight

Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Spag4 siRNA Oligos set (Rat)
45183176 3x 5 nmol

Spag4 siRNA Oligos set (Rat)

Ask
View Details
Lentiviral mouse Tcf7 shRNA (UAS) - Lentiviral mouse Tcf7 shRNA (UAS, RFP) (100)
GTR15110964 1 Vial

Lentiviral mouse Tcf7 shRNA (UAS) - Lentiviral mouse Tcf7 shRNA (UAS, RFP) (100)

Ask
View Details
Lentiviral mouse Daglb shRNA (UAS) - Lentiviral mouseDaglb shRNA (UAS, GFP) (25)
GTR15280280 1 Vial

Lentiviral mouse Daglb shRNA (UAS) - Lentiviral mouseDaglb shRNA (UAS, GFP) (25)

Ask
View Details
Frataxin (FXN) Antibody (FITC)
abx319032-01 20 µg

Frataxin (FXN) Antibody (FITC)

Ask
View Details
Frataxin (FXN) Antibody (FITC)
abx319032-02 50 µg

Frataxin (FXN) Antibody (FITC)

Ask
View Details
Frataxin (FXN) Antibody (FITC)
abx319032-03 100 µg

Frataxin (FXN) Antibody (FITC)

Ask
View Details