Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WBP1, Human (His)

WBP1 protein interacts with NEDD4, indicating a regulatory connection.It also engages with the WW domains of YAP1, WWP1, and WWP2, implicating its role in related signaling pathways.Additionally, WBP1 interacts with WWOX, showcasing its multifaceted involvement in cellular functions and regulatory networks.Further exploration is needed to understand the specific mechanisms and functional implications of these associations.WBP1 Protein, Human (His) is the recombinant human-derived WBP1 protein, expressed by E.coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

WBP1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/wbp1-protein-human-his.html

Smiles

GTNVEGVSSHQSAPPHQEGEPGAGVTPASTPPSCRYRRLTGDSGIELCPCPASGEGEPVKEVRVSATLPDLEDYSPCALPPESVPQIFPMGLSSSEGDIP

Molecular Formula

23559 (Gene_ID) Q96G27 (G170-P269) (Accession)

Molecular Weight

Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Interleukin 3 Receptor alpha (IL3RA) Antibody
abx213242-01 50 µL

Interleukin 3 Receptor alpha (IL3RA) Antibody

Ask
View Details
Interleukin 3 Receptor alpha (IL3RA) Antibody
abx213242-02 100 µL

Interleukin 3 Receptor alpha (IL3RA) Antibody

Ask
View Details
RPL9P14 CRISPR Knock Out 293T Cell Line (Human)
41935141 1x 10^6 Cells / 1.0 mL

RPL9P14 CRISPR Knock Out 293T Cell Line (Human)

Ask
View Details
OLFM3 (Olfactomedin 3, Noelin-3, Olfactomedin-3, Optimedin, NOE3, UNQ1924/PRO4399) (PE)
MBS6159218-01 0.1 mL

OLFM3 (Olfactomedin 3, Noelin-3, Olfactomedin-3, Optimedin, NOE3, UNQ1924/PRO4399) (PE)

Ask
View Details
OLFM3 (Olfactomedin 3, Noelin-3, Olfactomedin-3, Optimedin, NOE3, UNQ1924/PRO4399) (PE)
MBS6159218-02 5x 0.1 mL

OLFM3 (Olfactomedin 3, Noelin-3, Olfactomedin-3, Optimedin, NOE3, UNQ1924/PRO4399) (PE)

Ask
View Details
CD85j (CD85 antigen-like family member J, Leukocyte immunoglobulin-like receptor subfamily B member 1, Leukocyte immunoglobulin-like receptor 1, LIR-1, Monocyte/macrophage immunoglobulin-like receptor 7, Immunoglobulin-like transcript 2, LILRB1, ILT2, LIR1, MIR7) (MaxLight 490) discontinued
I7502-81B-ML490 100 µL

CD85j (CD85 antigen-like family member J, Leukocyte immunoglobulin-like receptor subfamily B member 1, Leukocyte immunoglobulin-like receptor 1, LIR-1, Monocyte/macrophage immunoglobulin-like receptor 7, Immunoglobulin-like transcript 2, LILRB1, ILT2, LIR1, MIR7) (MaxLight 490) discontinued

Ask
View Details