WBP1, Human (His)
WBP1 protein interacts with NEDD4, indicating a regulatory connection.It also engages with the WW domains of YAP1, WWP1, and WWP2, implicating its role in related signaling pathways.Additionally, WBP1 interacts with WWOX, showcasing its multifaceted involvement in cellular functions and regulatory networks.Further exploration is needed to understand the specific mechanisms and functional implications of these associations.WBP1 Protein, Human (His) is the recombinant human-derived WBP1 protein, expressed by E.coli , with N-6*His labeled tag.
Product Specifications
Product Name Alternative
WBP1 Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/wbp1-protein-human-his.html
Smiles
GTNVEGVSSHQSAPPHQEGEPGAGVTPASTPPSCRYRRLTGDSGIELCPCPASGEGEPVKEVRVSATLPDLEDYSPCALPPESVPQIFPMGLSSSEGDIP
Molecular Formula
23559 (Gene_ID) Q96G27 (G170-P269) (Accession)
Molecular Weight
Approximately 20 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items