Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-13, Mouse

IL-13 Protein, Mouse is an immunoregulatory cytokine produced primarily by activated Th2 cells, and also by mast cells and NK cells. IL-13 exerts anti-inflammatory effects on monocytes and macrophages and it inhibits the expression of inflammatory cytokines such as IL-1β, TNF-α, IL-6 and IL-8[1].

Product Specifications

Product Name Alternative

IL-13 Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-13-protein-mouse.html

Purity

98.0

Smiles

SVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFITKLLSYTKQLFRHGPF

Molecular Formula

16163 (Gene_ID) P20109 (S26-F131) (Accession)

Molecular Weight

Approximately 9-14 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]T Muchamuel, et al. IL-13 protects mice from lipopolysaccharide-induced lethal endotoxemia: correlation with down-modulation of TNF-alpha, IFN-gamma, and IL-12 production. J Immunol. 1997 Mar 15;158 (6) :2898-903.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EPHA2 (FITC)
561584-01 50 µg

EPHA2 (FITC)

Sign In for Pricing
View Details
EPHA2 (FITC)
561584-02 100 µg

EPHA2 (FITC)

Sign In for Pricing
View Details
PTGER4 peptide
orb217829-01 1 mg

PTGER4 peptide

Sign In for Pricing
View Details
PTGER4 peptide
orb217829-02 5 mg

PTGER4 peptide

Sign In for Pricing
View Details
PAXIP1 Peptide
orb2014065 100 µg

PAXIP1 Peptide

Sign In for Pricing
View Details
Rabbit Human SPT16 NT Antibody
orb108884 100 µg

Rabbit Human SPT16 NT Antibody

Sign In for Pricing
View Details