Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-13, Mouse

IL-13 Protein, Mouse is an immunoregulatory cytokine produced primarily by activated Th2 cells, and also by mast cells and NK cells. IL-13 exerts anti-inflammatory effects on monocytes and macrophages and it inhibits the expression of inflammatory cytokines such as IL-1β, TNF-α, IL-6 and IL-8[1].

Product Specifications

Product Name Alternative

IL-13 Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-13-protein-mouse.html

Purity

98.0

Smiles

SVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFITKLLSYTKQLFRHGPF

Molecular Formula

16163 (Gene_ID) P20109 (S26-F131) (Accession)

Molecular Weight

Approximately 9-14 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]T Muchamuel, et al. IL-13 protects mice from lipopolysaccharide-induced lethal endotoxemia: correlation with down-modulation of TNF-alpha, IFN-gamma, and IL-12 production. J Immunol. 1997 Mar 15;158 (6) :2898-903.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Thermosynechococcus elongatus D-fructose 1,6-bisphosphatase class 2/sedoheptulose 1,7-bisphosphatase (tll1276)
MBS1300112-01 0.02 mg (E-Coli)

Recombinant Thermosynechococcus elongatus D-fructose 1,6-bisphosphatase class 2/sedoheptulose 1,7-bisphosphatase (tll1276)

Sign In for Pricing
View Details
Recombinant Thermosynechococcus elongatus D-fructose 1,6-bisphosphatase class 2/sedoheptulose 1,7-bisphosphatase (tll1276)
MBS1300112-02 0.02 mg (Yeast)

Recombinant Thermosynechococcus elongatus D-fructose 1,6-bisphosphatase class 2/sedoheptulose 1,7-bisphosphatase (tll1276)

Sign In for Pricing
View Details
Recombinant Thermosynechococcus elongatus D-fructose 1,6-bisphosphatase class 2/sedoheptulose 1,7-bisphosphatase (tll1276)
MBS1300112-03 0.1 mg (E-Coli)

Recombinant Thermosynechococcus elongatus D-fructose 1,6-bisphosphatase class 2/sedoheptulose 1,7-bisphosphatase (tll1276)

Sign In for Pricing
View Details
Recombinant Thermosynechococcus elongatus D-fructose 1,6-bisphosphatase class 2/sedoheptulose 1,7-bisphosphatase (tll1276)
MBS1300112-04 0.1 mg (Yeast)

Recombinant Thermosynechococcus elongatus D-fructose 1,6-bisphosphatase class 2/sedoheptulose 1,7-bisphosphatase (tll1276)

Sign In for Pricing
View Details
Recombinant Thermosynechococcus elongatus D-fructose 1,6-bisphosphatase class 2/sedoheptulose 1,7-bisphosphatase (tll1276)
MBS1300112-05 0.02 mg (Baculovirus)

Recombinant Thermosynechococcus elongatus D-fructose 1,6-bisphosphatase class 2/sedoheptulose 1,7-bisphosphatase (tll1276)

Sign In for Pricing
View Details
Recombinant Thermosynechococcus elongatus D-fructose 1,6-bisphosphatase class 2/sedoheptulose 1,7-bisphosphatase (tll1276)
MBS1300112-06 0.02 mg (Mammalian-Cell)

Recombinant Thermosynechococcus elongatus D-fructose 1,6-bisphosphatase class 2/sedoheptulose 1,7-bisphosphatase (tll1276)

Sign In for Pricing
View Details