Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-13, Mouse

IL-13 Protein, Mouse is an immunoregulatory cytokine produced primarily by activated Th2 cells, and also by mast cells and NK cells. IL-13 exerts anti-inflammatory effects on monocytes and macrophages and it inhibits the expression of inflammatory cytokines such as IL-1β, TNF-α, IL-6 and IL-8[1].

Product Specifications

Product Name Alternative

IL-13 Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-13-protein-mouse.html

Purity

98.0

Smiles

SVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFITKLLSYTKQLFRHGPF

Molecular Formula

16163 (Gene_ID) P20109 (S26-F131) (Accession)

Molecular Weight

Approximately 9-14 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]T Muchamuel, et al. IL-13 protects mice from lipopolysaccharide-induced lethal endotoxemia: correlation with down-modulation of TNF-alpha, IFN-gamma, and IL-12 production. J Immunol. 1997 Mar 15;158 (6) :2898-903.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SMURF1 Rabbit Polyclonal Antibody (BF405)
orb2376807 100 µL

SMURF1 Rabbit Polyclonal Antibody (BF405)

Sign In for Pricing
View Details
Lentiviral human FAM49B shRNA (UAS) - Lentiviral human FAM49B shRNA (UAS, GFP) (100)
GTR15157773 1 Vial

Lentiviral human FAM49B shRNA (UAS) - Lentiviral human FAM49B shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
LOC690214 3'UTR GFP Stable Cell Line
TU262072 1.0 mL

LOC690214 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
RAP2C Protein Vector (Human) (pPB-C-His)
PV034341 500 ng

RAP2C Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
HIST1H4K Protein Vector (Human) (pPM-C-His)
PV083080 500 ng

HIST1H4K Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Recombinant Human Delta and Notch-like epidermal growth factor-related receptor (DNER), partial
CSB-YP818784HU-01 20 µg

Recombinant Human Delta and Notch-like epidermal growth factor-related receptor (DNER), partial

Sign In for Pricing
View Details