Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-13, Mouse

IL-13 Protein, Mouse is an immunoregulatory cytokine produced primarily by activated Th2 cells, and also by mast cells and NK cells. IL-13 exerts anti-inflammatory effects on monocytes and macrophages and it inhibits the expression of inflammatory cytokines such as IL-1β, TNF-α, IL-6 and IL-8[1].

Product Specifications

Product Name Alternative

IL-13 Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-13-protein-mouse.html

Purity

98.0

Smiles

SVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFITKLLSYTKQLFRHGPF

Molecular Formula

16163 (Gene_ID) P20109 (S26-F131) (Accession)

Molecular Weight

Approximately 9-14 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]T Muchamuel, et al. IL-13 protects mice from lipopolysaccharide-induced lethal endotoxemia: correlation with down-modulation of TNF-alpha, IFN-gamma, and IL-12 production. J Immunol. 1997 Mar 15;158 (6) :2898-903.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Melting Point Apparatus Thiele
2073042 1 Each

Melting Point Apparatus Thiele

Sign In for Pricing
View Details
TALDO1 Antibody
orb1328180 100 µg

TALDO1 Antibody

Sign In for Pricing
View Details
Sheep Serum Albumin Polyclonal Antibody, HRP Conjugated
A57538-100 100 µL

Sheep Serum Albumin Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
ANP32E Antibody (N-term)
orb1927202-01 50 µL

ANP32E Antibody (N-term)

Sign In for Pricing
View Details
ANP32E Antibody (N-term)
orb1927202-02 100 µL

ANP32E Antibody (N-term)

Sign In for Pricing
View Details
Src Protein Lysate (Mouse) with C-HA Tag
45438034 100 µg

Src Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details