Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ephrin B3, Mouse (HEK293, His)

Ephrin B3 protein, a transmembrane ligand, binds adjacent Eph receptors, triggering bidirectional signaling. It induces axon collapse in vitro and may influence axon guidance and orientation. Ephrin B3 interacts with GRIP1 and GRIP2, suggesting regulatory roles in development and cellular functions. Ephrin B3 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Ephrin B3 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

Ephrin B3 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ephrin-b3-protein-mouse-hek293-his.html

Purity

96.00

Smiles

LSLEPVYWNSANKRFQAEGGYVLYPQIGDRLDLLCPRARPPGPHSSPSYEFYKLYLVEGAQGRRCEAPPAPNLLLTCDRPDLDLRFTIKFQEYSPNLWGHEFRSHHDYYIIATSDGTREGLESLQGGVCLTRGMKVLLRVGQSPRGGAVPRKPVSEMPMERDRGAAHSAEPGRDTIPGDPSSNATSRGAEGPLPPPSMPA

Molecular Formula

13643 (Gene_ID) O35393 (L28-A227) (Accession)

Molecular Weight

Approximately 30 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

R MKP3 Antibody [APR14072G]
APR14072G-01 50 µL

R MKP3 Antibody [APR14072G]

Sign In for Pricing
View Details
R MKP3 Antibody [APR14072G]
APR14072G-02 100 µL

R MKP3 Antibody [APR14072G]

Sign In for Pricing
View Details
R MKP3 Antibody [APR14072G]
APR14072G-03 200 µL

R MKP3 Antibody [APR14072G]

Sign In for Pricing
View Details
R MKP3 Antibody [APR14072G]
APR14072G-04 400 µL

R MKP3 Antibody [APR14072G]

Sign In for Pricing
View Details
Methyl 3- (3,4-dichlorophenyl) propanoate
QEA70617-01 50 mg

Methyl 3- (3,4-dichlorophenyl) propanoate

Sign In for Pricing
View Details
Methyl 3- (3,4-dichlorophenyl) propanoate
QEA70617-02 0.5 g

Methyl 3- (3,4-dichlorophenyl) propanoate

Sign In for Pricing
View Details