Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

B7-1/CD80, Rabbit (HEK293, His)

B7-1/CD80 Protein is pivotal in providing the costimulatory signal crucial for T lymphocyte activation. T-cell proliferation and cytokine production hinge on the binding of CD28 or CTLA-4 to this receptor. As a crucial immune response mediator, B7-1/CD80 facilitates dynamic interplay between T cells and regulatory receptors, influencing essential processes for T lymphocyte activation and regulation in the immune system. B7-1/CD80 Protein, Rabbit (HEK293, His) is the recombinant Rabbit-derived B7-1/CD80 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

B7-1/CD80 Protein, Rabbit (HEK293, His), Rabbit, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/b7-1-cd80-protein-rabbit-hek-293-his.html

Smiles

GISQVTKSVKEMAALSCDYNISIDELARMRIYWQKDQQMVLSIISGQVEVWPEYKNRTFPDIINNLSLMILALRLSDKGTYTCVVQKNENGSFRREHLTSVTLSIRADFPVPSITDIGHPDPNVKRIRCSASGGFPEPRLAWMEDGEELNAVNTTVDQDLDTELYSVSSELDFNVTNNHSIVCLIKYGELSVSQIFPWSKPKQEPPIDQ

Molecular Formula

100009377 (Gene_ID) P42070 (G33-Q241) (Accession)

Molecular Weight

Approximately 30-50 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mucin 5AC (MUC5AC) (58M1), CF405S conjugate, 0.1mg/mL
BNC041003-100 1x 100 µL

Mucin 5AC (MUC5AC) (58M1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF647 conjugate, 0.1mg/mL
BNC471073-100 1x 100 µL

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (UCHL-1), CF405S conjugate, 0.1mg/mL
BNC040003-500 1x 500 µL

CD45RO (UCHL-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (C8/1035), CF640R conjugate, 0.1mg/mL
BNC401035-500 1x 500 µL

CD8 (C8/1035), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (2B11 + PD7/26), CF740 conjugate, 0.1mg/mL
BNC740745-500 1x 500 µL

CD45 / LCA (2B11 + PD7/26), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HCG-beta (Pregnancy & Choriocarcinoma Marker) (rHCGb/54), CF568 conjugate, 0.1mg/mL
BNC682197-100 1x 100 µL

HCG-beta (Pregnancy & Choriocarcinoma Marker) (rHCGb/54), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details