Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-3, Human (His)

IL-3 protein is mainly secreted by T lymphocytes, mast cells and osteoblasts and is critical for the generation and differentiation of hematopoietic progenitor cells. It stimulates mature basophils, eosinophils and monocytes, promoting functional activation. IL-3 Protein, Human (His) is the recombinant human-derived IL-3 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

IL-3 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-3-protein-human-his.html

Purity

98.0

Smiles

APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF

Molecular Formula

3562 (Gene_ID) P08700 (A20-F152) (Accession)

Molecular Weight

Approximately 13-17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

trans-Aconitic Acid
TRC-A189885-1G 1 g

trans-Aconitic Acid

Sign In for Pricing
View Details
TRAPPC3L Human Gene Knockout Kit (CRISPR)
KN427688 1 Kit

TRAPPC3L Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Benzyl D-Glucuronate
TRC-B279800-250MG 250 mg

Benzyl D-Glucuronate

Sign In for Pricing
View Details
2700059D21Rik (BC082305) Mouse Tagged ORF Clone
MG200699 10 µg

2700059D21Rik (BC082305) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Sohlh2 (CCDC169-SOHLH2) (NM_001198910) Human Over-expression Lysate
LC434277 20 µg

Sohlh2 (CCDC169-SOHLH2) (NM_001198910) Human Over-expression Lysate

Sign In for Pricing
View Details
ANGPTL7 Antibody
KC-2535-01 50 μL

ANGPTL7 Antibody

Sign In for Pricing
View Details