Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-3, Human (His)

IL-3 protein is mainly secreted by T lymphocytes, mast cells and osteoblasts and is critical for the generation and differentiation of hematopoietic progenitor cells. It stimulates mature basophils, eosinophils and monocytes, promoting functional activation. IL-3 Protein, Human (His) is the recombinant human-derived IL-3 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

IL-3 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-3-protein-human-his.html

Purity

98.0

Smiles

APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF

Molecular Formula

3562 (Gene_ID) P08700 (A20-F152) (Accession)

Molecular Weight

Approximately 13-17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TIMP1 Recombinant Antibody
V3596IHC-7ML 7 mL

TIMP1 Recombinant Antibody

Sign In for Pricing
View Details
OR2Z1 (NM_001004699) Human Over-expression Lysate
LY423887 100 µg

OR2Z1 (NM_001004699) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Human Chymotrypsin C Protein (His Tag)
PKSH031117 50 µg

Recombinant Human Chymotrypsin C Protein (His Tag)

Sign In for Pricing
View Details
Recombinant CD22 Antibody
RC-15381-01 50 μL

Recombinant CD22 Antibody

Sign In for Pricing
View Details
Recombinant CD22 Antibody
RC-15381-02 100 µL

Recombinant CD22 Antibody

Sign In for Pricing
View Details
Recombinant CD22 Antibody
RC-15381-03 1 mL

Recombinant CD22 Antibody

Sign In for Pricing
View Details