Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-3, Human (His)

IL-3 protein is mainly secreted by T lymphocytes, mast cells and osteoblasts and is critical for the generation and differentiation of hematopoietic progenitor cells. It stimulates mature basophils, eosinophils and monocytes, promoting functional activation. IL-3 Protein, Human (His) is the recombinant human-derived IL-3 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

IL-3 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-3-protein-human-his.html

Purity

98.0

Smiles

APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF

Molecular Formula

3562 (Gene_ID) P08700 (A20-F152) (Accession)

Molecular Weight

Approximately 13-17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr290 CRISPR/Cas9 KO Plasmid (m)
sc-434561 20 µg

Olfr290 CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details
LOC653428 Antibody
orb1240903 100 µL

LOC653428 Antibody

Sign In for Pricing
View Details
CD4 (CD4 Receptor, CD4mut, T Cell Surface Antigen T4/Leu3, T Cell Surface Glycoprotein CD4) (AP)
MBS6247618-01 0.1 mL

CD4 (CD4 Receptor, CD4mut, T Cell Surface Antigen T4/Leu3, T Cell Surface Glycoprotein CD4) (AP)

Sign In for Pricing
View Details
CD4 (CD4 Receptor, CD4mut, T Cell Surface Antigen T4/Leu3, T Cell Surface Glycoprotein CD4) (AP)
MBS6247618-02 5x 0.1 mL

CD4 (CD4 Receptor, CD4mut, T Cell Surface Antigen T4/Leu3, T Cell Surface Glycoprotein CD4) (AP)

Sign In for Pricing
View Details
PLD5 Protein Vector (Mouse) (pPM-C-HA)
36966024 500 ng

PLD5 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Human IL-32 ELISA Kit
CEK1763 96 Tests

Human IL-32 ELISA Kit

Sign In for Pricing
View Details