Animal-Free IL-4, Pig (His)
IL-4 protein is actively involved in the activation process of B cells and various cell types, acting as a costimulator of DNA synthesis. It induces expression of MHC class II molecules by resting B cells and enhances IgE and IgG1 secretion and cell surface expression. Animal-Free IL-4 Protein, Pig (His) is the recombinant pig-derived animal-FreeIL-4 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.
Product Specifications
Product Name Alternative
Animal-Free IL-4 Protein, Pig (His), Pig, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/animal-free-il-4-protein-pig-his.html
Purity
98.00
Smiles
MHKCDITLQEIIKTLNILTARKNSCMELPVTDVFAAPENTTEKETFCRASTVLRHIYRHHTCMKSLLSGLDRNLSSMANMTCSVHEAKKSTLKDFLERLKTIMKEKYSKC
Molecular Formula
397225 (Gene_ID) Q04745 (H25-C133) (Accession)
Molecular Weight
Approximately 15 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
Recombinant Human YjeF N-terminal domain-containing protein 3 (YJEFN3)
Recombinant Human YjeF N-terminal domain-containing protein 3 (YJEFN3)
Recombinant Human YjeF N-terminal domain-containing protein 3 (YJEFN3)
Recombinant Pseudendoclonium akinetum tRNA (Ile)-lysidine synthase, chloroplastic (tilS), partial
