KREMEN1, Human (HEK293, His)
KREMEN1 Protein, Human (HEK293, His) is the recombinant human-derived KREMEN1 protein, expressed by HEK293, with C-His labeled tag.
Product Specifications
Product Name Alternative
KREMEN1 Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/kremen1-protein-human-hek293-his.html
Purity
95.00
Smiles
ARPAPSPGLGPGPECFTANGADYRGTQNWTALQGGKPCLFWNETFQHPYNTLKYPNGEGGLGEHNYCRNPDGDVSPWCYVAEHEDGVYWKYCEIPACQMPGNLGCYKDHGNPPPLTGTSKTSNKLTIQTCISFCRSQRFKFAGMESGYACFCGNNPDYWKYGEAASTECNSVCFGDHTQPCGGDGRIILFDTLVGACGGNYSAMSSVVYSPDFPDTYATGRVCYWTIRVPGASHIHFSFPLFDIRDSADMVELLDGYTHRVLARFHGRSRPPLSFNVSLDFVILYFFSDRINQAQGFAVLYQAVKEELPQERPAVNQTVAEVITEQANLSVSAARSSKVLYVITTSPSHPPQTVPGSNSWAPPMGAGSHRVEGWT
Molecular Formula
83999 (Gene_ID) Q96MU8-2/NP_114434.3 (A20-T394) (Accession)
Molecular Weight
Approximately 60 kDa. The protein migrates as an approximately 60 kDa band under reducing SDS-PAGE due to glycosylation.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC940218-500 1x 500 µL
CD100 (Semaphorin-4D) (A8), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880352-500 1x 500 µL
CD31 / PECAM-1 (158-2B3), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740253-100 1x 100 µL
Cytokeratin, LMW (AE-1), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880218-100 1x 100 µL
CD100 (Semaphorin-4D) (A8), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details