Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TGF beta 1/TGFB1, Human (CHO)

TGF beta 1/TGFB1 Protein is initially identified as a growth factor that induces the growth of rodent fibroblasts. TGF beta 1/TGFB1 Protein inhibits the cell cycle in the G1 phase. TGF beta 1/TGFB1 is an endogenous factor controlling apoptosis in normal and pathological tissues. TGF beta 1/TGFB1 Protein, Human is a recombinant protein (A279-S390) produced by CHO cells[1][2].

Product Specifications

Product Name Alternative

TGF beta 1/TGFB1 Protein, Human (CHO), Human, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tgf-beta-1-protein-human.html

Purity

98.0

Smiles

ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS

Molecular Formula

7040 (Gene_ID) P01137 (A279-S390) (Accession)

Molecular Weight

Approximately 12-14 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]K. Miyazono, et al. A role of the latent TGF-beta 1-binding protein in the assembly and secretion of TGF-beta 1. The EMBO Journal (1991) 10:1091-1101.|[2]M Selvakumaran, et al. The novel primary response gene MyD118 and the proto-oncogenes myb, myc, and bcl-2 modulate transforming growth factor beta 1-induced apoptosis of myeloid leukemia cells. Mol Cell Biol. 1994 Apr;14 (4) :2352-60.|[3]Chambaz E.M., et al. Transforming Growth Factor-βs: A Multifunctional Cytokine Family. Implication in the Regulation of Adrenocortical Cell Endocrine Functions. 1991. |[4]Dulce Maroni, et al. TGFB1 disrupts the angiogenic potential of microvascular endothelial cells of the corpus luteum. Cell Sci. 2011 Jul 15;124 (Pt 14) :2501-10.|[5]Nan Wu, et al. LINC00941 promotes CRC metastasis through preventing SMAD4 protein degradation and activating the TGF-β/SMAD2/3 signaling pathway. Cell Death Differ. 2021 Jan;28 (1) :219-232. |[6]Hai Zhang, et al. Effects of transforming growth factor-beta 1 (TGF-beta1) on in vitro mineralization of human osteoblasts on implant materials. Biomaterials. 2003 May;24 (12) :2013-20. |[7]Paloma B Liton, et al. Cross-talk between TGF-beta1 and IL-6 in human trabecular meshwork cells. Mol Vis. 2009;15:326-34. Epub 2009 Feb 11.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPS6KA3 Protein Vector (Human) (pPM-C-His)
PV126837 500 ng

RPS6KA3 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Anti-GPR73 / PROKR1 Reference Antibody (Regeneron anti-PROKR1)
E24CHA457 100 µg

Anti-GPR73 / PROKR1 Reference Antibody (Regeneron anti-PROKR1)

Sign In for Pricing
View Details
Phospho-SIRT1 (Ser47) Polyclonal Antibody, Cy5 Conjugated
bs-3393R-Cy5 100 µL

Phospho-SIRT1 (Ser47) Polyclonal Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
ASK1 Antibody
253313 0.1 mg

ASK1 Antibody

Sign In for Pricing
View Details
GAA ELISA Kit (Human) (OKAN05305)
OKAN05305 96 Well

GAA ELISA Kit (Human) (OKAN05305)

Sign In for Pricing
View Details
UCHL5 sgRNA CRISPR Lentivector set (Human)
K2580801 3x 1.0 µg

UCHL5 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details