Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SCF, Human (P.pastoris)

SCF Protein, Human (P.pastoris), the c-kit ligand, is a two disulfide bridge-containing cytokine in the regulation of the development and function of hematopoietic cell lineages and other cells such as mast cells, germ cells, and melanocytes.

Product Specifications

Product Name Alternative

SCF Protein, Human (P.pastoris), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Related Pathways

Others

Assay Protocol

https://www.medchemexpress.com/cytokines/scf-protein-human-p-pastoris.html

Purity

98.0

Smiles

EGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVA

Molecular Formula

4254 (Gene_ID) P21583-1 (E26-A189) (Accession)

Molecular Weight

Approximately 18.6 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Akuta T, et al. Expression of bioactive soluble human stem cell factor (SCF) from recombinant Escherichia coli by coproduction of thioredoxin and efficient purification using arginine in affinity chromatography. Protein Expr Purif. 2015 Jan;105:1-7.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Cartilage
CS803573 5x 5 µm

Tissue FFPE Sections, Cartilage

Sign In for Pricing
View Details
(3-Nitrophenyl)hydrazine (13C6) Hydrochloride
TRC-N420521-10MG 10 mg

(3-Nitrophenyl)hydrazine (13C6) Hydrochloride

Sign In for Pricing
View Details
SOX9 / SRY-box 9 (SOX9/2387), CF647 conjugate, 0.1mg/mL
BNC472387-500 1x 500 µL

SOX9 / SRY-box 9 (SOX9/2387), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PLBD1 (NM_024829) Human Recombinant Protein
TP309501M 100 µg

PLBD1 (NM_024829) Human Recombinant Protein

Sign In for Pricing
View Details
2-Nitrophenol-3,4,5,6-d4
TRC-N496906-5MG 5 mg

2-Nitrophenol-3,4,5,6-d4

Sign In for Pricing
View Details
DLL1 Polyclonal Antibody
E-AB-70187-01 60 µL

DLL1 Polyclonal Antibody

Sign In for Pricing
View Details