Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SCF, Human (P.pastoris)

SCF Protein, Human (P.pastoris), the c-kit ligand, is a two disulfide bridge-containing cytokine in the regulation of the development and function of hematopoietic cell lineages and other cells such as mast cells, germ cells, and melanocytes.

Product Specifications

Product Name Alternative

SCF Protein, Human (P.pastoris), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Related Pathways

Others

Assay Protocol

https://www.medchemexpress.com/cytokines/scf-protein-human-p-pastoris.html

Purity

98.0

Smiles

EGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVA

Molecular Formula

4254 (Gene_ID) P21583-1 (E26-A189) (Accession)

Molecular Weight

Approximately 18.6 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Akuta T, et al. Expression of bioactive soluble human stem cell factor (SCF) from recombinant Escherichia coli by coproduction of thioredoxin and efficient purification using arginine in affinity chromatography. Protein Expr Purif. 2015 Jan;105:1-7.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

15-PGDH Recombinant Rabbit Monoclonal Antibody [JE60-23]
HA720047 100 µL

15-PGDH Recombinant Rabbit Monoclonal Antibody [JE60-23]

Sign In for Pricing
View Details
EASYStep Pro Bovine Cortisol (Cor) ELISA Kit
RDEp-Cor-b 96 Tests

EASYStep Pro Bovine Cortisol (Cor) ELISA Kit

Sign In for Pricing
View Details
Tissue Genomic DNA, Uterus
CD563564 5 µg

Tissue Genomic DNA, Uterus

Sign In for Pricing
View Details
Hexyltriphenylphosphonium Bromide
TRC-C382610-500MG 500 mg

Hexyltriphenylphosphonium Bromide

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS642464 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
1-Boc-4-(6-aminopyridin-3-yl)piperazine-d4
TRC-B621162-25MG 25 mg

1-Boc-4-(6-aminopyridin-3-yl)piperazine-d4

Sign In for Pricing
View Details