Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD47, Human (HEK293, Fc)

CD47 Protein, Human (HEK293, Fc) is a polypeptide chain with the C-terminal human IgG1 Fc fragment produced in HEK293 cells. CD47 is a prominent target in cancer immunotherapy.

Product Specifications

Product Name Alternative

CD47 Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd47-protein-human-hek293-fc.html

Purity

97.00

Smiles

QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSP

Molecular Formula

961 (Gene_ID) Q08722-1 (Q19-P139) (Accession)

Molecular Weight

Approximately 58.0 kDa.

References & Citations

[1]Huang Y, et al. Targeting CD47: the achievements and concerns of current studies on cancer immunotherapy. J Thorac Dis. 2017 Feb;9 (2) :E168-E174.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

IFT172, NT (IFT172, KIAA1179, Intraflagellar transport protein 172 homolog) (APC) discontinued
036895-APC 200 µL

IFT172, NT (IFT172, KIAA1179, Intraflagellar transport protein 172 homolog) (APC) discontinued

Sign In for Pricing
View Details
FineTest®700 Anti-Rat CD45 Antibody (OX-1)
F700-30009-01 50 Tests

FineTest®700 Anti-Rat CD45 Antibody (OX-1)

Sign In for Pricing
View Details
FineTest®700 Anti-Rat CD45 Antibody (OX-1)
F700-30009-02 100 Tests

FineTest®700 Anti-Rat CD45 Antibody (OX-1)

Sign In for Pricing
View Details
HSP90AB1 Rabbit Polyclonal Antibody [Clone ID: N/A]
TA326372 100 µL

HSP90AB1 Rabbit Polyclonal Antibody [Clone ID: N/A]

Sign In for Pricing
View Details
Somatostatin 28 Recombinant Antibody, AbBy Fluor™ 488 Conjugated
bsm-62828R-BF488 100 µL

Somatostatin 28 Recombinant Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
Suzetrigine
HY-148800-01 5 mg

Suzetrigine

Sign In for Pricing
View Details