Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD47, Human (HEK293, Fc)

CD47 Protein, Human (HEK293, Fc) is a polypeptide chain with the C-terminal human IgG1 Fc fragment produced in HEK293 cells. CD47 is a prominent target in cancer immunotherapy.

Product Specifications

Product Name Alternative

CD47 Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd47-protein-human-hek293-fc.html

Purity

97.00

Smiles

QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSP

Molecular Formula

961 (Gene_ID) Q08722-1 (Q19-P139) (Accession)

Molecular Weight

Approximately 58.0 kDa.

References & Citations

[1]Huang Y, et al. Targeting CD47: the achievements and concerns of current studies on cancer immunotherapy. J Thorac Dis. 2017 Feb;9 (2) :E168-E174.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Myo1c Mouse shRNA Plasmid (Locus ID 17913)
TR517720 1 Kit

Myo1c Mouse shRNA Plasmid (Locus ID 17913)

Sign In for Pricing
View Details
SETP7 Protein Vector (Human) (pPM-C-His)
PV128825 500 ng

SETP7 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Human Forkhead box protein M1,FOXM1 ELISA KIT
JOT-EK3671Hu 96 wells

Human Forkhead box protein M1,FOXM1 ELISA KIT

Sign In for Pricing
View Details
Nit1 Rat shRNA Lentiviral Particle (Locus ID 289222)
TL713575V 500 µL Each

Nit1 Rat shRNA Lentiviral Particle (Locus ID 289222)

Sign In for Pricing
View Details
pT7-6×His-COL6A2 Plasmid
PVT53160 2 µg

pT7-6×His-COL6A2 Plasmid

Sign In for Pricing
View Details
Mouse Monoclonal MRGPRF Antibody (916219) [Allophycocyanin/Cy7]
FAB8396APCCY7 0.1 mL

Mouse Monoclonal MRGPRF Antibody (916219) [Allophycocyanin/Cy7]

Sign In for Pricing
View Details