Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD47, Human (HEK293, Fc)

CD47 Protein, Human (HEK293, Fc) is a polypeptide chain with the C-terminal human IgG1 Fc fragment produced in HEK293 cells. CD47 is a prominent target in cancer immunotherapy.

Product Specifications

Product Name Alternative

CD47 Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd47-protein-human-hek293-fc.html

Purity

97.00

Smiles

QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSP

Molecular Formula

961 (Gene_ID) Q08722-1 (Q19-P139) (Accession)

Molecular Weight

Approximately 58.0 kDa.

References & Citations

[1]Huang Y, et al. Targeting CD47: the achievements and concerns of current studies on cancer immunotherapy. J Thorac Dis. 2017 Feb;9 (2) :E168-E174.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human BMPER Protein, N-His
YHJ23101 100 μg

Recombinant Human BMPER Protein, N-His

Sign In for Pricing
View Details
APRT, NT (Adenine Phosphoribosyltransferase) (MaxLight 550)
MBS6463869-01 0.1 mL

APRT, NT (Adenine Phosphoribosyltransferase) (MaxLight 550)

Sign In for Pricing
View Details
APRT, NT (Adenine Phosphoribosyltransferase) (MaxLight 550)
MBS6463869-02 5x 0.1 mL

APRT, NT (Adenine Phosphoribosyltransferase) (MaxLight 550)

Sign In for Pricing
View Details
Lentiviral human SLC6A19 sgRNA gene knockout kit - Lentiviral human SLC6A19 sgRNA gene knockout kit (25)
GTR15356913 1 Vial

Lentiviral human SLC6A19 sgRNA gene knockout kit - Lentiviral human SLC6A19 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
B.H.I. Broth w 10% Serum
MED1140 50 / PCK

B.H.I. Broth w 10% Serum

Sign In for Pricing
View Details
Duck Ethanolamine Phosphotransferase 1 (EPT1) ELISA Kit
MBS9909396 Inquire

Duck Ethanolamine Phosphotransferase 1 (EPT1) ELISA Kit

Sign In for Pricing
View Details