Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD47, Human (HEK293, Fc)

CD47 Protein, Human (HEK293, Fc) is a polypeptide chain with the C-terminal human IgG1 Fc fragment produced in HEK293 cells. CD47 is a prominent target in cancer immunotherapy.

Product Specifications

Product Name Alternative

CD47 Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd47-protein-human-hek293-fc.html

Purity

97.00

Smiles

QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSP

Molecular Formula

961 (Gene_ID) Q08722-1 (Q19-P139) (Accession)

Molecular Weight

Approximately 58.0 kDa.

References & Citations

[1]Huang Y, et al. Targeting CD47: the achievements and concerns of current studies on cancer immunotherapy. J Thorac Dis. 2017 Feb;9 (2) :E168-E174.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MFN2 (Mitofusin 2, Mitofusin-2, CMT2A, CMT2A2, CPRP1, HSG, KIAA0214, MARF, Transmembrane GTPase MFN2) (PE)
MBS6487964-01 0.2 mL

MFN2 (Mitofusin 2, Mitofusin-2, CMT2A, CMT2A2, CPRP1, HSG, KIAA0214, MARF, Transmembrane GTPase MFN2) (PE)

Sign In for Pricing
View Details
MFN2 (Mitofusin 2, Mitofusin-2, CMT2A, CMT2A2, CPRP1, HSG, KIAA0214, MARF, Transmembrane GTPase MFN2) (PE)
MBS6487964-02 5x 0.2 mL

MFN2 (Mitofusin 2, Mitofusin-2, CMT2A, CMT2A2, CPRP1, HSG, KIAA0214, MARF, Transmembrane GTPase MFN2) (PE)

Sign In for Pricing
View Details
Rabbit Polyclonal CDC123 Antibody
NBP2-68733 100 µL

Rabbit Polyclonal CDC123 Antibody

Sign In for Pricing
View Details
Rabbit Monoclonal HLA G Antibody (HLAG/8393R) [Janelia Fluor 646]
NBP3-20690JF646 0.1 mL

Rabbit Monoclonal HLA G Antibody (HLAG/8393R) [Janelia Fluor 646]

Sign In for Pricing
View Details
Skp1 Mouse Pre-designed siRNA Set A
HY-RS17896 1 Set

Skp1 Mouse Pre-designed siRNA Set A

Sign In for Pricing
View Details
Rabbit Polyclonal MEKK1 Antibody
NBP3-23539-100ul 100 µL

Rabbit Polyclonal MEKK1 Antibody

Sign In for Pricing
View Details