Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD47, Human (HEK293, Fc)

CD47 Protein, Human (HEK293, Fc) is a polypeptide chain with the C-terminal human IgG1 Fc fragment produced in HEK293 cells. CD47 is a prominent target in cancer immunotherapy.

Product Specifications

Product Name Alternative

CD47 Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd47-protein-human-hek293-fc.html

Purity

97.00

Smiles

QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSP

Molecular Formula

961 (Gene_ID) Q08722-1 (Q19-P139) (Accession)

Molecular Weight

Approximately 58.0 kDa.

References & Citations

[1]Huang Y, et al. Targeting CD47: the achievements and concerns of current studies on cancer immunotherapy. J Thorac Dis. 2017 Feb;9 (2) :E168-E174.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

V1RA3 shRNA Plasmid (m)
sc-154968-SH 20 µg

V1RA3 shRNA Plasmid (m)

Sign In for Pricing
View Details
PE anti-Baculovirus envelope gp64
GT06580 100 µg

PE anti-Baculovirus envelope gp64

Sign In for Pricing
View Details
Gfra3 Mouse Pre-designed siRNA Set A
HY-RS19200 1 Set

Gfra3 Mouse Pre-designed siRNA Set A

Sign In for Pricing
View Details
Recombinant HIV-1 nef Protein, Untagged, E.coli-100ug
QP14022-EC-100ug 100ug

Recombinant HIV-1 nef Protein, Untagged, E.coli-100ug

Sign In for Pricing
View Details
Human TMEM191B shRNA Plasmid
abx968954-01 150 µg

Human TMEM191B shRNA Plasmid

Sign In for Pricing
View Details
Human TMEM191B shRNA Plasmid
abx968954-02 300 µg

Human TMEM191B shRNA Plasmid

Sign In for Pricing
View Details