Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD47, Human (HEK293, Fc)

CD47 Protein, Human (HEK293, Fc) is a polypeptide chain with the C-terminal human IgG1 Fc fragment produced in HEK293 cells. CD47 is a prominent target in cancer immunotherapy.

Product Specifications

Product Name Alternative

CD47 Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd47-protein-human-hek293-fc.html

Purity

97.00

Smiles

QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSP

Molecular Formula

961 (Gene_ID) Q08722-1 (Q19-P139) (Accession)

Molecular Weight

Approximately 58.0 kDa.

References & Citations

[1]Huang Y, et al. Targeting CD47: the achievements and concerns of current studies on cancer immunotherapy. J Thorac Dis. 2017 Feb;9 (2) :E168-E174.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR10H1, CT (OR10H1, Olfactory receptor 10H1, Olfactory receptor OR19-27) (MaxLight 405)
MBS6327958-01 0.1 mL

OR10H1, CT (OR10H1, Olfactory receptor 10H1, Olfactory receptor OR19-27) (MaxLight 405)

Sign In for Pricing
View Details
OR10H1, CT (OR10H1, Olfactory receptor 10H1, Olfactory receptor OR19-27) (MaxLight 405)
MBS6327958-02 5x 0.1 mL

OR10H1, CT (OR10H1, Olfactory receptor 10H1, Olfactory receptor OR19-27) (MaxLight 405)

Sign In for Pricing
View Details
Stap2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K7403607 1.0 µg DNA

Stap2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Lentiviral human TANK shRNA (UAS) - Lentiviral human TANK shRNA (UAS, GFP) plasmid
GTR15340189 1 Vial

Lentiviral human TANK shRNA (UAS) - Lentiviral human TANK shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Recombinant Clostridium botulinum Botulinum neurotoxin type B (botB), partial
RPC29640-01 20 µg

Recombinant Clostridium botulinum Botulinum neurotoxin type B (botB), partial

Sign In for Pricing
View Details
Recombinant Clostridium botulinum Botulinum neurotoxin type B (botB), partial
RPC29640-02 100 µg

Recombinant Clostridium botulinum Botulinum neurotoxin type B (botB), partial

Sign In for Pricing
View Details