Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD47, Human (HEK293, Fc)

CD47 Protein, Human (HEK293, Fc) is a polypeptide chain with the C-terminal human IgG1 Fc fragment produced in HEK293 cells. CD47 is a prominent target in cancer immunotherapy.

Product Specifications

Product Name Alternative

CD47 Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd47-protein-human-hek293-fc.html

Purity

97.00

Smiles

QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSP

Molecular Formula

961 (Gene_ID) Q08722-1 (Q19-P139) (Accession)

Molecular Weight

Approximately 58.0 kDa.

References & Citations

[1]Huang Y, et al. Targeting CD47: the achievements and concerns of current studies on cancer immunotherapy. J Thorac Dis. 2017 Feb;9 (2) :E168-E174.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RNASE4 (NM_002937) Human Over-expression Lysate
LC419001 20 µg

RNASE4 (NM_002937) Human Over-expression Lysate

Sign In for Pricing
View Details
Sh2d1b2 (NM_001033499) Mouse Untagged Clone
MC215098 10 µg

Sh2d1b2 (NM_001033499) Mouse Untagged Clone

Sign In for Pricing
View Details
Rhesus Monkey Recombinant Cytochrome P450 Enzymes
NHFF-1123-HX608 Each

Rhesus Monkey Recombinant Cytochrome P450 Enzymes

Sign In for Pricing
View Details
Creatine D3 hydrate
MBS3613834-01 5 mg

Creatine D3 hydrate

Sign In for Pricing
View Details
Creatine D3 hydrate
MBS3613834-02 10 mg

Creatine D3 hydrate

Sign In for Pricing
View Details
Creatine D3 hydrate
MBS3613834-03 25 mg

Creatine D3 hydrate

Sign In for Pricing
View Details