Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD47, Human (HEK293, Fc)

CD47 Protein, Human (HEK293, Fc) is a polypeptide chain with the C-terminal human IgG1 Fc fragment produced in HEK293 cells. CD47 is a prominent target in cancer immunotherapy.

Product Specifications

Product Name Alternative

CD47 Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd47-protein-human-hek293-fc.html

Purity

97.00

Smiles

QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSP

Molecular Formula

961 (Gene_ID) Q08722-1 (Q19-P139) (Accession)

Molecular Weight

Approximately 58.0 kDa.

References & Citations

[1]Huang Y, et al. Targeting CD47: the achievements and concerns of current studies on cancer immunotherapy. J Thorac Dis. 2017 Feb;9 (2) :E168-E174.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD71 (66IG10), CF488A conjugate, 0.1mg/mL
BNC880871-100 1x 100 µL

CD71 (66IG10), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), CF488A conjugate, 0.1mg/mL
BNC880333-500 1x 500 µL

CD8 (RIV11), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (156-3C11), CF594 conjugate, 0.1mg/mL
BNC940460-100 1x 100 µL

CD44 Standard (156-3C11), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF594 conjugate, 0.1mg/mL
BNC940630-100 1x 100 µL

Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, pan (Epithelial Marker) (KRTH/1576R + KRTL/1577R), CF740 conjugate, 0.1mg/mL
BNC741600-100 1x 100 µL

Cytokeratin, pan (Epithelial Marker) (KRTH/1576R + KRTL/1577R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD68 (Macrophage Marker) (LAMP4/1830), CF640R conjugate, 0.1mg/mL
BNC401830-500 1x 500 µL

CD68 (Macrophage Marker) (LAMP4/1830), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details