Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD47, Human (HEK293, Fc)

CD47 Protein, Human (HEK293, Fc) is a polypeptide chain with the C-terminal human IgG1 Fc fragment produced in HEK293 cells. CD47 is a prominent target in cancer immunotherapy.

Product Specifications

Product Name Alternative

CD47 Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd47-protein-human-hek293-fc.html

Purity

97.00

Smiles

QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSP

Molecular Formula

961 (Gene_ID) Q08722-1 (Q19-P139) (Accession)

Molecular Weight

Approximately 58.0 kDa.

References & Citations

[1]Huang Y, et al. Targeting CD47: the achievements and concerns of current studies on cancer immunotherapy. J Thorac Dis. 2017 Feb;9 (2) :E168-E174.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

LINGO2 (NM_152570) Human Tagged ORF Clone
RG214465 10 µg

LINGO2 (NM_152570) Human Tagged ORF Clone

Sign In for Pricing
View Details
C16orf54 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K0311808 1.0 µg DNA

C16orf54 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
SH3BP5 siRNA (Mouse)
MBS8240447-01 15 nmol

SH3BP5 siRNA (Mouse)

Sign In for Pricing
View Details
SH3BP5 siRNA (Mouse)
MBS8240447-02 30 nmol

SH3BP5 siRNA (Mouse)

Sign In for Pricing
View Details
SH3BP5 siRNA (Mouse)
MBS8240447-03 5x 30 nmol

SH3BP5 siRNA (Mouse)

Sign In for Pricing
View Details
Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) YFT2 Polyclonal Antibody
MBS7150409 Inquire

Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) YFT2 Polyclonal Antibody

Sign In for Pricing
View Details