Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD47, Human (HEK293, Fc)

CD47 Protein, Human (HEK293, Fc) is a polypeptide chain with the C-terminal human IgG1 Fc fragment produced in HEK293 cells. CD47 is a prominent target in cancer immunotherapy.

Product Specifications

Product Name Alternative

CD47 Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd47-protein-human-hek293-fc.html

Purity

97.00

Smiles

QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSP

Molecular Formula

961 (Gene_ID) Q08722-1 (Q19-P139) (Accession)

Molecular Weight

Approximately 58.0 kDa.

References & Citations

[1]Huang Y, et al. Targeting CD47: the achievements and concerns of current studies on cancer immunotherapy. J Thorac Dis. 2017 Feb;9 (2) :E168-E174.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant HCV Genotype-1a NS3 Antigen, GST-tagged
HCV-187 1 Vial

Recombinant HCV Genotype-1a NS3 Antigen, GST-tagged

Sign In for Pricing
View Details
RGR Antibody
MBS7120450-01 0.05 mg

RGR Antibody

Sign In for Pricing
View Details
RGR Antibody
MBS7120450-02 0.1 mg

RGR Antibody

Sign In for Pricing
View Details
RGR Antibody
MBS7120450-03 5x 0.1 mg

RGR Antibody

Sign In for Pricing
View Details
Rabbit Anti-NU214/NUP214 Polyclonal Antibody
PAV2624 100 μL

Rabbit Anti-NU214/NUP214 Polyclonal Antibody

Sign In for Pricing
View Details
Cacnb1 (NM_001159319) Mouse Tagged ORF Clone
MR223007 10 µg

Cacnb1 (NM_001159319) Mouse Tagged ORF Clone

Sign In for Pricing
View Details