Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD47, Human (HEK293, Fc)

CD47 Protein, Human (HEK293, Fc) is a polypeptide chain with the C-terminal human IgG1 Fc fragment produced in HEK293 cells. CD47 is a prominent target in cancer immunotherapy.

Product Specifications

Product Name Alternative

CD47 Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd47-protein-human-hek293-fc.html

Purity

97.00

Smiles

QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSP

Molecular Formula

961 (Gene_ID) Q08722-1 (Q19-P139) (Accession)

Molecular Weight

Approximately 58.0 kDa.

References & Citations

[1]Huang Y, et al. Targeting CD47: the achievements and concerns of current studies on cancer immunotherapy. J Thorac Dis. 2017 Feb;9 (2) :E168-E174.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPR155 (NM_001033045) Human Tagged Lenti ORF Clone
RC220157L4 10 µg

GPR155 (NM_001033045) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Human papillomavirus 35 PCR kit
PCR-H468-48D 50T

Human papillomavirus 35 PCR kit

Sign In for Pricing
View Details
Mouse Shisa2 activation kit by CRISPRa
GA213593 1 Kit

Mouse Shisa2 activation kit by CRISPRa

Sign In for Pricing
View Details
(R) -1-phenylbutan-1-amine
OR1040912-01 100 mg

(R) -1-phenylbutan-1-amine

Sign In for Pricing
View Details
(R) -1-phenylbutan-1-amine
OR1040912-02 250 mg

(R) -1-phenylbutan-1-amine

Sign In for Pricing
View Details
(R) -1-phenylbutan-1-amine
OR1040912-03 1 g

(R) -1-phenylbutan-1-amine

Sign In for Pricing
View Details