Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD47, Human (HEK293, Fc)

CD47 Protein, Human (HEK293, Fc) is a polypeptide chain with the C-terminal human IgG1 Fc fragment produced in HEK293 cells. CD47 is a prominent target in cancer immunotherapy.

Product Specifications

Product Name Alternative

CD47 Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd47-protein-human-hek293-fc.html

Purity

97.00

Smiles

QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSP

Molecular Formula

961 (Gene_ID) Q08722-1 (Q19-P139) (Accession)

Molecular Weight

Approximately 58.0 kDa.

References & Citations

[1]Huang Y, et al. Targeting CD47: the achievements and concerns of current studies on cancer immunotherapy. J Thorac Dis. 2017 Feb;9 (2) :E168-E174.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GENLISA™ Monkey Cross-linked C-telopeptide of Type I Collagen (CTXI) ELISA
KLW0194 1x 96 Well

GENLISA™ Monkey Cross-linked C-telopeptide of Type I Collagen (CTXI) ELISA

Sign In for Pricing
View Details
anti-PDGF Receptor alpha
YF-PA13688 100 ug

anti-PDGF Receptor alpha

Sign In for Pricing
View Details
Laminin beta 1 Rabbit Monoclonal Antibody
E56G0602 100 µL

Laminin beta 1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
SOX11 Polyclonal Antibody
RA34954-01 50 µL

SOX11 Polyclonal Antibody

Sign In for Pricing
View Details
SOX11 Polyclonal Antibody
RA34954-02 100 µL

SOX11 Polyclonal Antibody

Sign In for Pricing
View Details
WD repeat-containing protein 73 (WDR73) Antibody (HRP)
abx346627-01 50 µL

WD repeat-containing protein 73 (WDR73) Antibody (HRP)

Sign In for Pricing
View Details