CD47, Human (HEK293, Fc)
CD47 Protein, Human (HEK293, Fc) is a polypeptide chain with the C-terminal human IgG1 Fc fragment produced in HEK293 cells. CD47 is a prominent target in cancer immunotherapy.
Product Specifications
Product Name Alternative
CD47 Protein, Human (HEK293, Fc), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/cd47-protein-human-hek293-fc.html
Purity
97.00
Smiles
QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSP
Molecular Formula
961 (Gene_ID) Q08722-1 (Q19-P139) (Accession)
Molecular Weight
Approximately 58.0 kDa.
References & Citations
[1]Huang Y, et al. Targeting CD47: the achievements and concerns of current studies on cancer immunotherapy. J Thorac Dis. 2017 Feb;9 (2) :E168-E174.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Browse additional items from our catalog
Mouse Acetyl Coenzyme A Acetyltransferase 2 (ACAT2) ELISA Kit
Mouse Acetyl Coenzyme A Acetyltransferase 2 (ACAT2) ELISA Kit
FBXO22 (F-box Only Protein 22, F-box Protein 22, FBX22, F-box Protein FBX22p44, FIST Domain Containing 1, FISTC1, FLJ13986, MGC31799) (Biotin)
Rabbit anti-Escherichia coli O157:H7 galK Polyclonal Antibody
Human Monocyte Chemotactic Protein-3 (CCL7) (Recombinant)