Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD47, Human (HEK293, Fc)

CD47 Protein, Human (HEK293, Fc) is a polypeptide chain with the C-terminal human IgG1 Fc fragment produced in HEK293 cells. CD47 is a prominent target in cancer immunotherapy.

Product Specifications

Product Name Alternative

CD47 Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd47-protein-human-hek293-fc.html

Purity

97.00

Smiles

QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSP

Molecular Formula

961 (Gene_ID) Q08722-1 (Q19-P139) (Accession)

Molecular Weight

Approximately 58.0 kDa.

References & Citations

[1]Huang Y, et al. Targeting CD47: the achievements and concerns of current studies on cancer immunotherapy. J Thorac Dis. 2017 Feb;9 (2) :E168-E174.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Colloidal Gold Labeled Fetuin, 1mL 40nm
GP-05-40 1 mL

Colloidal Gold Labeled Fetuin, 1mL 40nm

Sign In for Pricing
View Details
TREM1 (Triggering Receptor Expressed on Myeloid Cells 1, TREM-1, Triggering Receptor Expressed on Monocytes 1, CD354) (FITC)
MBS6397119-01 0.1 mL

TREM1 (Triggering Receptor Expressed on Myeloid Cells 1, TREM-1, Triggering Receptor Expressed on Monocytes 1, CD354) (FITC)

Sign In for Pricing
View Details
TREM1 (Triggering Receptor Expressed on Myeloid Cells 1, TREM-1, Triggering Receptor Expressed on Monocytes 1, CD354) (FITC)
MBS6397119-02 5x 0.1 mL

TREM1 (Triggering Receptor Expressed on Myeloid Cells 1, TREM-1, Triggering Receptor Expressed on Monocytes 1, CD354) (FITC)

Sign In for Pricing
View Details
ISO-1, Macrophage migration inhibitory factor (MIF) antagonist
TBI1185-5MG 5 mg

ISO-1, Macrophage migration inhibitory factor (MIF) antagonist

Sign In for Pricing
View Details
Human Albumin AssayLite™ Antibody (FITC Conjugate)
12001-05041 2x 75 µg

Human Albumin AssayLite™ Antibody (FITC Conjugate)

Sign In for Pricing
View Details
PLRG1 Antibody
A31441-100UL 100 µL

PLRG1 Antibody

Sign In for Pricing
View Details