Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD47, Human (HEK293, Fc)

CD47 Protein, Human (HEK293, Fc) is a polypeptide chain with the C-terminal human IgG1 Fc fragment produced in HEK293 cells. CD47 is a prominent target in cancer immunotherapy.

Product Specifications

Product Name Alternative

CD47 Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd47-protein-human-hek293-fc.html

Purity

97.00

Smiles

QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSP

Molecular Formula

961 (Gene_ID) Q08722-1 (Q19-P139) (Accession)

Molecular Weight

Approximately 58.0 kDa.

References & Citations

[1]Huang Y, et al. Targeting CD47: the achievements and concerns of current studies on cancer immunotherapy. J Thorac Dis. 2017 Feb;9 (2) :E168-E174.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MEF2B (NM_001145785) Human Tagged ORF Clone
RC227214 10 µg

MEF2B (NM_001145785) Human Tagged ORF Clone

Sign In for Pricing
View Details
KIAA0748 (TESPA1) (NM_001136030) Human Tagged ORF Clone
RC226975 10 µg

KIAA0748 (TESPA1) (NM_001136030) Human Tagged ORF Clone

Sign In for Pricing
View Details
Scml4 3'UTR Lenti-reporter-Luc Vector
43173086 1.0 µg

Scml4 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
MT3 (Metallothionein 3, GIF, GIFB, GRIF) (MaxLight 550)
MBS6218136-01 0.1 mL

MT3 (Metallothionein 3, GIF, GIFB, GRIF) (MaxLight 550)

Sign In for Pricing
View Details
MT3 (Metallothionein 3, GIF, GIFB, GRIF) (MaxLight 550)
MBS6218136-02 5x 0.1 mL

MT3 (Metallothionein 3, GIF, GIFB, GRIF) (MaxLight 550)

Sign In for Pricing
View Details
Fpr-rs3 Protein Vector (Mouse) (pPB-N-His)
PV180243 500 ng

Fpr-rs3 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details