Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD47, Human (HEK293, Fc)

CD47 Protein, Human (HEK293, Fc) is a polypeptide chain with the C-terminal human IgG1 Fc fragment produced in HEK293 cells. CD47 is a prominent target in cancer immunotherapy.

Product Specifications

Product Name Alternative

CD47 Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd47-protein-human-hek293-fc.html

Purity

97.00

Smiles

QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSP

Molecular Formula

961 (Gene_ID) Q08722-1 (Q19-P139) (Accession)

Molecular Weight

Approximately 58.0 kDa.

References & Citations

[1]Huang Y, et al. Targeting CD47: the achievements and concerns of current studies on cancer immunotherapy. J Thorac Dis. 2017 Feb;9 (2) :E168-E174.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Or7e176 qPCR Primer Pair
QM66214S 200 Tests

Mouse Or7e176 qPCR Primer Pair

Sign In for Pricing
View Details
TNN Lentiviral Vector (Mouse) (pLenti-GIII-CMV )
47243064 1.0 µg DNA

TNN Lentiviral Vector (Mouse) (pLenti-GIII-CMV )

Sign In for Pricing
View Details
Rnf225 (NM_029809) Mouse Tagged ORF Clone
MG215028 10 µg

Rnf225 (NM_029809) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Angiopoietin-1 (Human) BioAssayTM ELISA Kit
471705 96 Tests

Angiopoietin-1 (Human) BioAssayTM ELISA Kit

Sign In for Pricing
View Details
Actin Alpha 2, Smooth Muscle (ACTA2) Antibody
abx132253-01 100 µL

Actin Alpha 2, Smooth Muscle (ACTA2) Antibody

Sign In for Pricing
View Details
Actin Alpha 2, Smooth Muscle (ACTA2) Antibody
abx132253-02 200 µL

Actin Alpha 2, Smooth Muscle (ACTA2) Antibody

Sign In for Pricing
View Details