Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD47, Human (HEK293, Fc)

CD47 Protein, Human (HEK293, Fc) is a polypeptide chain with the C-terminal human IgG1 Fc fragment produced in HEK293 cells. CD47 is a prominent target in cancer immunotherapy.

Product Specifications

Product Name Alternative

CD47 Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd47-protein-human-hek293-fc.html

Purity

97.00

Smiles

QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSP

Molecular Formula

961 (Gene_ID) Q08722-1 (Q19-P139) (Accession)

Molecular Weight

Approximately 58.0 kDa.

References & Citations

[1]Huang Y, et al. Targeting CD47: the achievements and concerns of current studies on cancer immunotherapy. J Thorac Dis. 2017 Feb;9 (2) :E168-E174.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NTE-122 (dihydrochloride)
HY-121762 1 Each

NTE-122 (dihydrochloride)

Sign In for Pricing
View Details
Rabbit Polyclonal PPIL3 Antibody
NBP2-99600-100ul 100 µL

Rabbit Polyclonal PPIL3 Antibody

Sign In for Pricing
View Details
Recombinant Rabbit Anti-Human S100P Monoclonal Antibody, clone CQ7129
CABT-Z193R 100 µl

Recombinant Rabbit Anti-Human S100P Monoclonal Antibody, clone CQ7129

Sign In for Pricing
View Details
S100 alpha 2 (S100A2) Human shRNA Plasmid Kit (Locus ID 6273)
TR309669 1 Kit

S100 alpha 2 (S100A2) Human shRNA Plasmid Kit (Locus ID 6273)

Sign In for Pricing
View Details
HHATL Human Gene Knockout Kit (CRISPR)
KN405433 1 Kit

HHATL Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Bpifb6 Rat shRNA Lentiviral Particle (Locus ID 311558)
TL706340V 500 µL Each

Bpifb6 Rat shRNA Lentiviral Particle (Locus ID 311558)

Sign In for Pricing
View Details