Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD47, Human (HEK293, Fc)

CD47 Protein, Human (HEK293, Fc) is a polypeptide chain with the C-terminal human IgG1 Fc fragment produced in HEK293 cells. CD47 is a prominent target in cancer immunotherapy.

Product Specifications

Product Name Alternative

CD47 Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd47-protein-human-hek293-fc.html

Purity

97.00

Smiles

QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSP

Molecular Formula

961 (Gene_ID) Q08722-1 (Q19-P139) (Accession)

Molecular Weight

Approximately 58.0 kDa.

References & Citations

[1]Huang Y, et al. Targeting CD47: the achievements and concerns of current studies on cancer immunotherapy. J Thorac Dis. 2017 Feb;9 (2) :E168-E174.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Tram1 ELISA Kit
ELI-16928r 96 Tests

Rat Tram1 ELISA Kit

Sign In for Pricing
View Details
Lentiviral mouse Pxn shRNA (UAS) - Lentiviral mouse Pxn shRNA (UAS, GFP) plasmid
GTR15189178 1 Vial

Lentiviral mouse Pxn shRNA (UAS) - Lentiviral mouse Pxn shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
CLAN, NT (Caspase Recruitment Domain Family Member 12, CARD12) (MaxLight 490)
MBS6452142-01 0.1 mL

CLAN, NT (Caspase Recruitment Domain Family Member 12, CARD12) (MaxLight 490)

Sign In for Pricing
View Details
CLAN, NT (Caspase Recruitment Domain Family Member 12, CARD12) (MaxLight 490)
MBS6452142-02 5x 0.1 mL

CLAN, NT (Caspase Recruitment Domain Family Member 12, CARD12) (MaxLight 490)

Sign In for Pricing
View Details
HA/Hemagglutinin, H1N1 (ACF41933, HEK293, His)
HY-P74099 1 Each

HA/Hemagglutinin, H1N1 (ACF41933, HEK293, His)

Sign In for Pricing
View Details
Anti-PhosphoThreonine Ascites, Antibody
GWB-F3088C 100 µL

Anti-PhosphoThreonine Ascites, Antibody

Sign In for Pricing
View Details