Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TIM-4/TIMD-4, Human (Biotinylated, HEK293, His)

TIM-4/TIMD-4 protein is a multifunctional phosphatidylserine receptor involved in multiple immune response functions. It participates in phagocytosis of apoptotic cells and exerts a bimodal regulatory effect on T cell activation—inhibiting initial T cell activation while promoting the proliferation of activated T cells through AKT1 and ERK1/2 phosphorylation. TIM-4/TIMD-4 Protein, Human (Biotinylated, HEK293, His) is the recombinant human-derived TIM-4/TIMD-4 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

TIM-4/TIMD-4 Protein, Human (Biotinylated, HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tim-4-timd-4-protein-human-biotinylated-hek293-his.html

Purity

97.10

Smiles

MSKEPLILWLMIEFWWLYLTPVTSETVVTEVLGHRVTLPCLYSSWSHNSNSMCWGKDQCPYSGCKEALIRTDGMRVTSRKSAKYRLQGTIPRGDVSLTILNPSESDSGVYCCRIEVPGWFNDVKINVRLNLQRASTTTHRTATTTTRRTTTTSPTTTRQMTTTPAALPTTVVTTPDLTTGTPLQMTTIAVFTTANTCLSLTPSTLPEEATGLLTPEPSKEGPILTAESETVLPSDSWSSVESTSADTVLLTSKESKVWDLPSTSHVSMWKTSDSVSSPQPGASDTAVPEQNKTTKTGQMDGIPMSMKNEMPISQL

Molecular Formula

91937 (Gene_ID) AAH08988.1 (E25-L315) (Accession)

Molecular Weight

Approximately 32.7 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD35 / CR1 (E11), CF594 conjugate, 0.1mg/mL
BNC940040-100 1x 100 µL

CD35 / CR1 (E11), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF568 conjugate, 0.1mg/mL
BNC680039-500 1x 500 µL

CD34 (ICO-115), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 / ICAM3 (CG106), CF405S conjugate, 0.1mg/mL
BNC042216-100 1x 100 µL

CD50 / ICAM3 (CG106), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF568 conjugate, 0.1mg/mL
BNC681429-100 1x 100 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
EpCAM / CD326 (Epithelial Marker) (EGP40/2041R), CF405S conjugate, 0.1mg/mL
BNC042041-500 1x 500 µL

EpCAM / CD326 (Epithelial Marker) (EGP40/2041R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ARF1 (Golgi Apparatus Marker) (3F1), CF594 conjugate, 0.1mg/mL
BNC942029-500 1x 500 µL

ARF1 (Golgi Apparatus Marker) (3F1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details