Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Phosphorylated adapter RNA export protein (Phax)

Product Specifications

Product Name Alternative

RNA U small nuclear RNA export adapter protein

Abbreviation

Recombinant Mouse Phax protein

Gene Name

Phax

UniProt

Q9JJT9

Expression Region

2-385aa

Organism

Mus musculus (Mouse)

Target Sequence

ALEAGDMEEGQLSDSDSDMTVVPSDRPLQMAKVLGGGSAACAPVSHYRTVKHVDSSEESLDSDDDCSLWKRKRQKCHNTPPKPEPFPFGPSGQKTALNGGKKVNNIWGAVLQEQNQDAVATELGILGMEGSIDRSRQSETYNYLLAKKLAKKESQEYTKELDKDLDEYMHGDKKPGSKEDENGQGHLKRKRPVRDRLGNRVEMNYKGRYEITEEDAPEKVADEIAFRLQEPKKDLIARVVRILGNKKAIELLMETAEVEQNGGLFIMNGSRRRTPGGVFLNLLKNTPSISEEQIKDIFYVENQKEYENKKAARKRRTQLLGKKMKQAIKSLNFQEDDDTSRETFASDTNEALASLDEAQEGPGETKLDAEEAIEVDHPQDLDIF

Tag

N-terminal 10xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

A phosphoprotein adapter involved in the XPO1-mediated U snRNA export from the nucleus. Bridge components required for U snRNA export, the cap binding complex (CBC) -bound snRNA on the one hand and the GTPase Ran in its active GTP-bound form together with the export receptor XPO1 on the other. Its phosphorylation in the nucleus is required for U snRNA export complex assembly and export, while its dephosphorylation in the cytoplasm causes export complex disassembly. It is recycled back to the nucleus via the importin alpha/beta heterodimeric import receptor. The directionality of nuclear export is thought to be conferred by an asymmetric distribution of the GTP- and GDP-bound forms of Ran between the cytoplasm and nucleus. Its compartmentalized phosphorylation cycle may also contribute to the directionality of export. Binds strongly to m7G-capped U1 and U5 small nuclear RNAs (snRNAs) in a sequence-unspecific manner and phosphorylation-independent manner. Also plays a role in the biogenesis of U3 small nucleolar RNA (snoRNA) . Involved in the U3 snoRNA transport from nucleoplasm to Cajal bodies. Binds strongly to m7G-capped U3, U8 and U13 precursor snoRNAs and weakly to trimethylated (TMG) -capped U3, U8 and U13 snoRNAs. Binds also to telomerase RNA.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

46.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Lung
CS643560 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
Anti-DYKDDDDK Tag Antibody
KC-17391-01 50 μL

Anti-DYKDDDDK Tag Antibody

Sign In for Pricing
View Details
Anti-DYKDDDDK Tag Antibody
KC-17391-02 100 µL

Anti-DYKDDDDK Tag Antibody

Sign In for Pricing
View Details
Anti-DYKDDDDK Tag Antibody
KC-17391-03 1 mL

Anti-DYKDDDDK Tag Antibody

Sign In for Pricing
View Details
Tissue Total RNA, Ovary: left
CR561662 5 µg

Tissue Total RNA, Ovary: left

Sign In for Pricing
View Details
EMILIN2 Rat Monoclonal Antibody [Clone ID: 828B3B3]
AM31890PU-N 100 µg

EMILIN2 Rat Monoclonal Antibody [Clone ID: 828B3B3]

Sign In for Pricing
View Details