Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BD-1, Rat

BD-1 Protein, Rat is antimicrobial peptide that defends epithelial surfaces including the skin, gastrointestinal, and respiratory tracts.

Product Specifications

Product Name Alternative

BD-1 Protein, Rat, Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/bd-1-protein-rat.html

Purity

99.00

Smiles

DQYRCLQNGGFCLRSSCPSHTKLQGTCKPDKPNCCRS

Molecular Formula

83687 (Gene_ID) O89117 (D33-S69) (Accession)

Molecular Weight

Approximately 7 kDa

References & Citations

[1]Semple F, et al. β-Defensins: multifunctional modulators of infection, inflammation and more? J Innate Immun. 2012;4 (4) :337-48.|[2]Hiratsuka T, et al. Nucleotide sequence and expression of rat beta-defensin-1: its significance in diabetic rodent models. Nephron. 2001 May;88 (1) :65-70.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SUZ12 Recombinant Rabbit Monoclonal Antibody [JJ09-04]
ET1701-62 100 µL

SUZ12 Recombinant Rabbit Monoclonal Antibody [JJ09-04]

Sign In for Pricing
View Details
Frozen Tissue Sections, Breast
CS502940 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details
Monohydroxyisononyl Phthalate-d4
TRC-M547542-25MG 25 mg

Monohydroxyisononyl Phthalate-d4

Sign In for Pricing
View Details
CD83 (NM_001040280) Human Over-expression Lysate
LC421736 20 µg

CD83 (NM_001040280) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue FFPE Sections, Myometrium
CS700374 5x 5 µm

Tissue FFPE Sections, Myometrium

Sign In for Pricing
View Details
Tissue FFPE Sections, Lymphoid tissue
CS807265 5x 5 µm

Tissue FFPE Sections, Lymphoid tissue

Sign In for Pricing
View Details