Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BD-1, Rat

BD-1 Protein, Rat is antimicrobial peptide that defends epithelial surfaces including the skin, gastrointestinal, and respiratory tracts.

Product Specifications

Product Name Alternative

BD-1 Protein, Rat, Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/bd-1-protein-rat.html

Purity

99.00

Smiles

DQYRCLQNGGFCLRSSCPSHTKLQGTCKPDKPNCCRS

Molecular Formula

83687 (Gene_ID) O89117 (D33-S69) (Accession)

Molecular Weight

Approximately 7 kDa

References & Citations

[1]Semple F, et al. β-Defensins: multifunctional modulators of infection, inflammation and more? J Innate Immun. 2012;4 (4) :337-48.|[2]Hiratsuka T, et al. Nucleotide sequence and expression of rat beta-defensin-1: its significance in diabetic rodent models. Nephron. 2001 May;88 (1) :65-70.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ATAD1 activation kit by CRISPRa
GA113748 1 Kit

Human ATAD1 activation kit by CRISPRa

Sign In for Pricing
View Details
Irganox 1035
TRC-I764153-50G 50 g

Irganox 1035

Sign In for Pricing
View Details
5-Bromovaleronitrile
TRC-B699498-2.5G 2.5 g

5-Bromovaleronitrile

Sign In for Pricing
View Details
L-(+)-Lactic Acid-13C3 Sodium Salt
TRC-L113507-5MG 5 mg

L-(+)-Lactic Acid-13C3 Sodium Salt

Sign In for Pricing
View Details
Dewaxing Solution
#99876-30ML 1x 30 mL

Dewaxing Solution

Sign In for Pricing
View Details
SARS-CoV-2 S Gene Tagged ORF Clone (Native Sequence)
VC102566 10 µg

SARS-CoV-2 S Gene Tagged ORF Clone (Native Sequence)

Sign In for Pricing
View Details